Cusabio Escherichia coli Recombinants
Recombinant Escherichia coli Signal peptidase I (lepB), partial | CSB-EP360447ENV
- SKU:
- CSB-EP360447ENV
- Availability:
- 3 - 7 Working Days
Description
Recombinant Escherichia coli Signal peptidase I (lepB), partial | CSB-EP360447ENV | Cusabio
Alternative Name(s): Leader peptidase I
Gene Names: lepB
Research Areas: Microbiology
Organism: Escherichia coli (strain K12)
AA Sequence: RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 78-324aa
Sequence Info: Partial
MW: 43.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins.
Reference: "Sequence of the leader peptidase gene of Escherichia coli and the orientation of leader peptidase in the bacterial envelope."Wolfe P.B., Wickner W., Goodman J.M.J. Biol. Chem. 258:12073-12080(1983)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Cell inner membrane, Multi-pass membrane protein
Protein Families: Peptidase S26 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P00803
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A