Recombinant Escherichia coli Beta-lactamase CTX-M-1 (bla) | CSB-YP333368ENL

(No reviews yet) Write a Review
SKU:
CSB-YP333368ENL
Availability:
25 - 35 Working Days
  • Recombinant Escherichia coli Beta-lactamase CTX-M-1 (bla)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$459.60 - $1,614.00

Description

Recombinant Escherichia coli Beta-lactamase CTX-M-1 (bla) | CSB-YP333368ENL | Cusabio

Alternative Name(s): Beta-lactamase MEN-1Cefotaximase 1

Gene Names: bla

Research Areas: Others

Organism: Escherichia coli

AA Sequence: QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 29-291aa

Sequence Info: Full Length of Mature Protein

MW: 30.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins.

Reference: Close amino acid sequence relationship between the new plasmid-mediated extended-spectrum beta-lactamase MEN-1 and chromosomally encoded enzymes of Klebsiella oxytoca.Barthelemy M., Peduzzi J., Bernard H., Tancrede C., Labia R.Biochim. Biophys. Acta 1122:15-22(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins.

Involvement in disease:

Subcellular Location:

Protein Families: Class-A beta-lactamase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P28585

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose