null

Recombinant Escherichia coli Beta-lactamase CTX-M-1 (bla) | CSB-YP333368ENLc7

(No reviews yet) Write a Review
SKU:
CSB-YP333368ENLc7
Availability:
3 - 7 Working Days
  • Recombinant Escherichia coli Beta-lactamase CTX-M-1 (bla)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €2,023.00
Frequently bought together:

Description

Recombinant Escherichia coli Beta-lactamase CTX-M-1 (bla) | CSB-YP333368ENLc7 | Cusabio

Alternative Name(s): Beta-lactamase MEN-1 Cefotaximase 1 men1

Gene Names: bla

Research Areas: Epigenetics and Nuclear Signaling

Organism: Escherichia coli

AA Sequence: QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL

Source: Yeast

Tag Info: C-terminal 6xHis-tagged

Expression Region: 29-291aa

Sequence Info: Full Length of Mature Protein

MW: 30.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins.

Reference: "Sequences of beta-lactamase genes encoding CTX-M-1 (MEN-1) and CTX-M-2 and relationship of their amino acid sequences with those of other beta-lactamases." Bauernfeind A., Stemplinger I., Jungwirth R., Casellas J.M. Antimicrob. Agents Chemother. 40:509-513(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins.

Involvement in disease:

Subcellular Location:

Protein Families: Class-A beta-lactamase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P28585

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose