Recombinant Epstein-Barr virus DNA polymerase catalytic subunit (BALF5) , partial | CSB-EP355978EFA

(No reviews yet) Write a Review
SKU:
CSB-EP355978EFA
Availability:
13 - 23 Working Days
  • Recombinant Epstein-Barr virus DNA polymerase catalytic subunit (BALF5) , partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Epstein-Barr virus DNA polymerase catalytic subunit (BALF5) , partial | CSB-EP355978EFA | Cusabio

Alternative Name(s): BALF5DNA polymerase catalytic subunit; EC 2.7.7.7

Gene Names: BALF5

Research Areas: Others

Organism: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

AA Sequence: MSGGLFYNPFLRPNKGLLKKPDKEYLRLIPKCFQTPGAAGVVDVRGPQPPLCFYQDSLTVVGGDEDGKGMWWRQRAQEGTARPEADTHGSPLDFHVYDILETVYTHEKCAVIPSDKQGYVVPCGIVIKLLGRRKADGASVCVNVFGQQAYFYASAPQGLDVEFAVLSALKASTFDRRTPCRVSVEKVTRRSIMGYGNHAGDYHKITLSHP

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-210aa

Sequence Info: Partial

MW: 39.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Replicates viral genomic DNA in the late phase of lytic infection, producing long concateric DNA. The replication complex is composed of six viral proteins: the DNA polymerase, processivity factor, primase, primase-associated factor, helicase, and ssDNA-binding protein.

Reference: A functional and structural basis for TCR cross-reactivity in multiple sclerosis.Lang H.L.E., Jacobsen H., Ikemizu S., Andersson C., Harlos K., Madsen L., Hjorth P., Sondergaard L., Svejgaard A., Wucherpfennig K., Stuart D.I., Bell J.I., Jones E.Y., Fugger L.Nat. Immunol. 3:940-943(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Replicates viral genomic DNA in the late phase of lytic infection, producing long concatemeric DNA. The replication complex is composed of six viral proteins

Involvement in disease:

Subcellular Location: Host nucleus

Protein Families: DNA polymerase type-B family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P03198

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose