Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 3 (EBNA3), partial | CSB-EP319032EFA

Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 3 (EBNA3), partial | CSB-EP319032EFA | Cusabio

Alternative Name(s): Epstein-Barr nuclear antigen 3A (EBNA-3A) (EBV nuclear antigen 3A)

Gene Names: EBNA3

Research Areas: Others

Organism: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

AA Sequence: MDKDRPGPPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAHLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYA

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-138aa

Sequence Info: Partial

MW: 22.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Plays an essential role for activation and immortalization of human B-cells. Represses transcription of viral promoters TP1 and Cp through interaction with host RBPJ, and inhibits EBNA2-mediated activation of these promoters. Since Cp is the promoter for all EBNA mRNAs, EBNA3A probably contributes to a negative autoregulatory control loop.

Reference: "Definitive identification of a member of the Epstein-Barr virus nuclear protein 3 family." Hennessy K., Wang F., Bushman E.W., Kieff E. Proc. Natl. Acad. Sci. U.S.A. 83:5693-5697(1986)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays an essential role for activation and immortalization of human B-cells. Represses transcription of viral promoters TP1 and Cp through interaction with host RBPJ, and inhibits EBNA2-mediated activation of these promoters. Since Cp is the promoter for all EBNA mRNAs, EBNA3A probably contributes to a negative autoregulatory control loop.

Involvement in disease:

Subcellular Location: Host nucleus matrix

Protein Families: Herpesviridae EBNA-3 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P12977

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A