Recombinant Entamoeba histolytica Multidrug resistance protein 1 (MDR1) | CSB-YP001046EKM

(No reviews yet) Write a Review
SKU:
CSB-YP001046EKM
Availability:
25 - 35 Working Days
  • Recombinant Entamoeba histolytica Multidrug resistance protein 1 (MDR1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €2,023.00

Description

Recombinant Entamoeba histolytica Multidrug resistance protein 1 (MDR1) | CSB-YP001046EKM | Cusabio

Alternative Name(s): P-glycoprotein

Gene Names: MDR1

Research Areas: Others

Organism: Entamoeba histolytica

AA Sequence: SGCGKSTTIQLIQRNYEPNGGRVTLDGKDIRELNIKWLRNQIGLVGQEPVLFAGTIRENIMLGAKEGETLSKDEMIECAKMANAHEFVSKLAEGYDTLIGEKGALLSGGQRQRI

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-114aa

Sequence Info: Full Length

MW: 14.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

Reference: Emetine-resistant mutants of Entamoeba histolytica overexpress mRNAs for multidrug resistance.Samuelson J., Ayala P., Orozco E., Wirth D.Mol. Biochem. Parasitol. 38:281-290(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

Involvement in disease:

Subcellular Location: Membrane, Multi-pass membrane protein

Protein Families: ABC transporter superfamily, ABCB family, Multidrug resistance exporter (TC 3.A.1.201) subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P16875

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose