Recombinant Drosophila melanogaster Ubiquitin-conjugating enzyme E2-17KDA (UbcD6) | CSB-YP328517DLU

(No reviews yet) Write a Review
SKU:
CSB-YP328517DLU
Availability:
25 - 35 Working Days
  • Recombinant Drosophila melanogaster Ubiquitin-conjugating enzyme E2-17KDA (UbcD6)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$459.60 - $1,614.00

Description

Recombinant Drosophila melanogaster Ubiquitin-conjugating enzyme E2-17KDA (UbcD6) | CSB-YP328517DLU | Cusabio

Alternative Name(s): Ubiquitin carrier proteinUbiquitin-protein ligase

Gene Names: UbcD6

Research Areas: Others

Organism: Drosophila melanogaster (Fruit fly)

AA Sequence: MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-151aa

Sequence Info: Full Length

MW: 19.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the covalent attachment of ubiquitin to other proteins. Required for postreplication repair of UV-damaged DNA.

Reference: Dhr6, a Drosophila homolog of the yeast DNA-repair gene RAD6.Koken M.H.M., Reynolds P., Bootsma D., Hoeijmakers J.H.J., Prakash S., Prakash L.Proc. Natl. Acad. Sci. U.S.A. 88:3832-3836(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the covalent attachment of ubiquitin to other proteins. Required for postreplication repair of UV-damaged DNA

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: Ubiquitin-conjugating enzyme family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P25153

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose