Cusabio Drosophila melanogaster Recombinants
Recombinant Drosophila melanogaster Ubiquitin-conjugating enzyme E2-17KDA (UbcD6) | CSB-EP328517DLU
- SKU:
- CSB-EP328517DLU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Drosophila melanogaster Ubiquitin-conjugating enzyme E2-17KDA (UbcD6) | CSB-EP328517DLU | Cusabio
Alternative Name(s): Ubiquitin carrier proteinUbiquitin-protein ligase
Gene Names: UbcD6
Research Areas: Others
Organism: Drosophila melanogaster (Fruit fly)
AA Sequence: MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKACVEQSFID
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-151aa
Sequence Info: Full Length
MW: 33.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Catalyzes the covalent attachment of ubiquitin to other proteins. Required for postreplication repair of UV-damaged DNA.
Reference: Dhr6, a Drosophila homolog of the yeast DNA-repair gene RAD6.Koken M.H.M., Reynolds P., Bootsma D., Hoeijmakers J.H.J., Prakash S., Prakash L.Proc. Natl. Acad. Sci. U.S.A. 88:3832-3836(1991)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Catalyzes the covalent attachment of ubiquitin to other proteins. Required for postreplication repair of UV-damaged DNA
Involvement in disease:
Subcellular Location: Nucleus
Protein Families: Ubiquitin-conjugating enzyme family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P25153
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A