Cusabio Danio rerio Recombinants
Recombinant Danio rerio von Willebrand factor C domain-containing protein 2-like (vwc2l) | CSB-YP531776DIL
- SKU:
- CSB-YP531776DIL
- Availability:
- 25 - 35 Working Days
Description
Recombinant Danio rerio von Willebrand factor C domain-containing protein 2-like (vwc2l) | CSB-YP531776DIL | Cusabio
Alternative Name(s): vwc2l; si:ch211-207d8.1; von Willebrand factor C domain-containing protein 2-like
Gene Names: vwc2l
Research Areas: Others
Organism: Danio rerio (Zebrafish) (Brachydanio rerio)
AA Sequence: ASVGPEDYPAADEAERTANNDIIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCVCTEDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYRGKTYKILEEFKPSPCEWCRCEPNNEVHCVVADCAVPECVNPVYEPEQCCPICKNGPNCFAGTTIIPAGIEVKVDDCTICRCHSGDWWKPAQCLRRECLNGQATS
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 22-223aa
Sequence Info: Full Length of Mature Protein
MW: 24.4 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: May play a role in bone differentiation and matrix mineralization. May play a role in neural development.
Reference: "A novel neural-specific BMP antagonist, Brorin-like, of the Chordin family." Miwa H., Miyake A., Kouta Y., Shimada A., Yamashita Y., Nakayama Y., Yamauchi H., Konishi M., Itoh N. FEBS Lett. 583:3643-3648(2009)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May play a role in bone differentiation and matrix mineralization (By similarity). May play a role in neural development.
Involvement in disease:
Subcellular Location: Secreted, Cell junction, synapse
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: B0UZC8
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A