Recombinant Danio rerio von Willebrand factor C domain-containing protein 2-like (vwc2l) | CSB-YP531776DIL

(No reviews yet) Write a Review
SKU:
CSB-YP531776DIL
Availability:
25 - 35 Working Days
  • Recombinant Danio rerio von Willebrand factor C domain-containing protein 2-like (vwc2l)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$459.60 - $1,614.00

Description

Recombinant Danio rerio von Willebrand factor C domain-containing protein 2-like (vwc2l) | CSB-YP531776DIL | Cusabio

Alternative Name(s): vwc2l; si:ch211-207d8.1; von Willebrand factor C domain-containing protein 2-like

Gene Names: vwc2l

Research Areas: Others

Organism: Danio rerio (Zebrafish) (Brachydanio rerio)

AA Sequence: ASVGPEDYPAADEAERTANNDIIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCVCTEDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYRGKTYKILEEFKPSPCEWCRCEPNNEVHCVVADCAVPECVNPVYEPEQCCPICKNGPNCFAGTTIIPAGIEVKVDDCTICRCHSGDWWKPAQCLRRECLNGQATS

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-223aa

Sequence Info: Full Length of Mature Protein

MW: 24.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May play a role in bone differentiation and matrix mineralization. May play a role in neural development.

Reference: "A novel neural-specific BMP antagonist, Brorin-like, of the Chordin family." Miwa H., Miyake A., Kouta Y., Shimada A., Yamashita Y., Nakayama Y., Yamauchi H., Konishi M., Itoh N. FEBS Lett. 583:3643-3648(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play a role in bone differentiation and matrix mineralization (By similarity). May play a role in neural development.

Involvement in disease:

Subcellular Location: Secreted, Cell junction, synapse

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: B0UZC8

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose