Cusabio Danio rerio Recombinants
Recombinant Danio rerio Metallothionein-2 (mt2) | CSB-YP772046DIL
- SKU:
- CSB-YP772046DIL
- Availability:
- 25 - 35 Working Days
Description
Recombinant Danio rerio Metallothionein-2 (mt2) | CSB-YP772046DIL | Cusabio
Alternative Name(s): MT-2
Gene Names: mt2
Research Areas: Others
Organism: Danio rerio (Zebrafish) (Brachydanio rerio)
AA Sequence: MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-60aa
Sequence Info: Full Length
MW: 8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Metallothioneins have a high content of cysteine residues that bind various heavy metals.
Reference: "Expression of metallothionein gene during embryonic and early larval development in zebrafish."Chen W.-Y., John J.A.C., Lin C.-H., Lin H.-F., Wu S.-C., Lin C.-H., Chang C.-Y.Aquat. Toxicol. 69:215-227(2004)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Metallothioneins have a high content of cysteine residues that bind various heavy metals.
Involvement in disease:
Subcellular Location:
Protein Families: Metallothionein superfamily, Type 1 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q7ZSY6
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A