Recombinant Danio rerio Metallothionein-2 (mt2) | CSB-YP772046DIL

(No reviews yet) Write a Review
SKU:
CSB-YP772046DIL
Availability:
25 - 35 Working Days
  • Recombinant Danio rerio Metallothionein-2 (mt2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €1,345.00

Description

Recombinant Danio rerio Metallothionein-2 (mt2) | CSB-YP772046DIL | Cusabio

Alternative Name(s): MT-2

Gene Names: mt2

Research Areas: Others

Organism: Danio rerio (Zebrafish) (Brachydanio rerio)

AA Sequence: MDPCECAKTGTCNCGATCKCTNCQCTTCKKSCCSCCPSGCSKCASGCVCKGNSCGSSCCQ

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-60aa

Sequence Info: Full Length

MW: 8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Metallothioneins have a high content of cysteine residues that bind various heavy metals.

Reference: "Expression of metallothionein gene during embryonic and early larval development in zebrafish."Chen W.-Y., John J.A.C., Lin C.-H., Lin H.-F., Wu S.-C., Lin C.-H., Chang C.-Y.Aquat. Toxicol. 69:215-227(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Metallothioneins have a high content of cysteine residues that bind various heavy metals.

Involvement in disease:

Subcellular Location:

Protein Families: Metallothionein superfamily, Type 1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q7ZSY6

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose