Recombinant Chlamydia trachomatis Major outer membrane porin, serovar B (ompA) | CSB-EP332912DSA

(No reviews yet) Write a Review
SKU:
CSB-EP332912DSA
Availability:
3 - 7 Working Days
£281.60 - £1,361.60

Description

Recombinant Chlamydia trachomatis Major outer membrane porin, serovar B (ompA) | CSB-EP332912DSA | Cusabio

Alternative Name(s): ompA; omp1B; Major outer membrane porin; serovar B; MOMP

Gene Names: ompA

Research Areas: Microbiology

Organism: Chlamydia trachomatis

AA Sequence: LPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWVDAISMRMGYYGDFVFDRVLKTDVNKEFQMGAKPTTTTGNAVAPSTLTARENPAYGRHMQDAEMFTNAACMALNIWDRFDVFCTLGASSGYLKGNSASFNLVGLFGNNENQTKVSNGAFVPNMSLDQSVVELYTDTAFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGKELPLDLTAGTDAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDADTIRIAQPKSAETIFDVTTLNPTIAGAGDVKTSAEGQLGDTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 23-394aa

Sequence Info: Full Length of Mature Protein

MW: 47.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: In elementary bodies provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the large cysteine-rich periplasmic protein. It has been described in publications as the Sarkosyl-insoluble COMC, and serves as the functional equivalent of peptidoglycan.

Reference: "Diversity of Chlamydia trachomatis major outer membrane protein genes." Stephens R.S., Sanchez-Pescador R., Wagar E.A., Inouye C., Urdea M.S. J. Bacteriol. 169:3879-3885(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P23421

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose