Cusabio Chlamydia trachomatis Recombinants
Recombinant Chlamydia trachomatis Major outer membrane porin, serovar B (ompA) | CSB-EP332912DSA
- SKU:
- CSB-EP332912DSA
- Availability:
- 3 - 7 Working Days
Description
Recombinant Chlamydia trachomatis Major outer membrane porin, serovar B (ompA) | CSB-EP332912DSA | Cusabio
Alternative Name(s): ompA; omp1B; Major outer membrane porin; serovar B; MOMP
Gene Names: ompA
Research Areas: Microbiology
Organism: Chlamydia trachomatis
AA Sequence: LPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWVDAISMRMGYYGDFVFDRVLKTDVNKEFQMGAKPTTTTGNAVAPSTLTARENPAYGRHMQDAEMFTNAACMALNIWDRFDVFCTLGASSGYLKGNSASFNLVGLFGNNENQTKVSNGAFVPNMSLDQSVVELYTDTAFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGKELPLDLTAGTDAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDADTIRIAQPKSAETIFDVTTLNPTIAGAGDVKTSAEGQLGDTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 23-394aa
Sequence Info: Full Length of Mature Protein
MW: 47.7 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: In elementary bodies provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the large cysteine-rich periplasmic protein. It has been described in publications as the Sarkosyl-insoluble COMC, and serves as the functional equivalent of peptidoglycan.
Reference: "Diversity of Chlamydia trachomatis major outer membrane protein genes." Stephens R.S., Sanchez-Pescador R., Wagar E.A., Inouye C., Urdea M.S. J. Bacteriol. 169:3879-3885(1987)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P23421
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A