Cusabio Gallus gallus Recombinants
Recombinant Chicken (Chicken) Mitochondrial Rho GTPase 1 (RHOT1), partial | CSB-EP720036CH
- SKU:
- CSB-EP720036CH
- Availability:
- 13 - 23 Working Days
Description
Recombinant Chicken (Chicken) Mitochondrial Rho GTPase 1 (RHOT1), partial | CSB-EP720036CH | Cusabio
Alternative Name(s): MIRO-1 Alternative name(s): Ras homolog gene family member T1
Gene Names: RHOT1
Research Areas: Tags & Cell Markers
Organism: Gallus gallus (Chicken)
AA Sequence: MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQNDEQLYHEISQANVICIVYAVNNKNSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVECSAKNLKNRSELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFRISDQDNDGTLNDAELNFFQRICFNT
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-219aa
Sequence Info: Partial
MW: 41 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution (By similarity).
Reference: "Full-length cDNAs from chicken bursal lymphocytes to facilitate gene function analysis."Caldwell R.B., Kierzek A.M., Arakawa H., Bezzubov Y., Zaim J., Fiedler P., Kutter S., Blagodatski A., Kostovska D., Koter M., Plachy J., Carninci P., Hayashizaki Y., Buerstedde J.-M.Genome Biol. 6:R6.1-R6.9(2005).
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution (By similarity).
Involvement in disease:
Subcellular Location: Mitochondrion outer membrane, Single-pass type IV membrane protein
Protein Families: Mitochondrial Rho GTPase family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q5ZM73
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A