Recombinant Centruroides elegans Beta-toxin CeII8 | CSB-BP315578CFW

Recombinant Centruroides elegans Beta-toxin CeII8 | CSB-BP315578CFW | Cusabio

Alternative Name(s): Beta-toxin CeII8

Gene Names: N/A

Research Areas: Others

Organism: Centruroides elegans (Bark scorpion)

AA Sequence: KKDGYPVNMEECRYNCWKNAYCDKLCKEKKGQSGYCYGWNLSCWCIGLPDNTNTKMNPFCQTAD

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-64aa

Sequence Info: Full Length

MW: 11.3

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Beta toxins bind at site-4 of sodium channels and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. Has a selective effect toward Nav1.7/SCN9A which plays a role in pain mechanisms, and especially in the development of inflammatory pain. Shows no lethality toward mice.

Reference: "Isolation and characterization of two novel scorpion toxins: The alpha-toxin-like CeII8, specific for Na(v)1.7 channels and the classical anti-mammalian CeII9, specific for Na(v)1.4 channels." Vandendriessche T., Olamendi-Portugal T., Zamudio F.Z., Possani L.D., Tytgat J. Toxicon 56:613-623(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0CH40

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A