Recombinant Centruroides noxius Beta-mammal toxin Cn2 | CSB-YP355662DRB

Recombinant Centruroides noxius Beta-mammal toxin Cn2 | CSB-YP355662DRB | Cusabio

Alternative Name(s): Toxin II.9.2.2

Gene Names: N/A

Research Areas: Others

Organism: Centruroides noxius (Mexican scorpion)

AA Sequence: KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 17-82aa

Sequence Info: Full Length of Mature Protein

MW: 9.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals.

Reference: "Solution structure of toxin 2 from Centruroides noxius Hoffmann, a beta-scorpion neurotoxin acting on sodium channels."Pintar A., Possani L.D., Delepierre M.J. Mol. Biol. 287:359-367(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Mammal beta-toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the activation voltage to more negative potentials. This toxin is active against mammals.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily

Tissue Specificity: Expressed by the venom gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01495

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A