Recombinant Brucella abortus biovar 1 25 kDa outer-membrane immunogenic protein (omp25) | CSB-EP670430BWS

(No reviews yet) Write a Review
SKU:
CSB-EP670430BWS
Availability:
13 - 23 Working Days
  • Recombinant Brucella abortus biovar 1 25 kDa outer-membrane immunogenic protein (omp25)
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP670430BWS could indicate that this peptide derived from E.coli-expressed Brucella abortus biovar 1 (strain 9-941) omp25.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP670430BWS could indicate that this peptide derived from E.coli-expressed
€352.00 - €1,702.00

Description

Recombinant Brucella abortus biovar 1 25 kDa outer-membrane immunogenic protein (omp25) | CSB-EP670430BWS | Cusabio

Alternative Name(s): omp25; BruAb1_0720; 25 kDa outer-membrane immunogenic protein

Gene Names: omp25

Research Areas: Signal Transduction

Organism: Brucella abortus biovar 1 (strain 9-941)

AA Sequence: ADAIQEQPPVPAPVEVAPQYSWAGGYTGLYLGYGWNKAKTSTVGSIKPDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLNPVMPYLTAGIAGSQIKLNNGLDDESKFRVGWTAGAGLEAKLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDIRVGIGYKF

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 24-213aa

Sequence Info: Full Length of Mature Protein

MW: 27.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Completion of the genome sequence of Brucella abortus and comparison to the highly similar genomes of Brucella melitensis and Brucella suis." Halling S.M., Peterson-Burch B.D., Bricker B.J., Zuerner R.L., Qing Z., Li L.-L., Kapur V., Alt D.P., Olsen S.C. J. Bacteriol. 187:2715-2726(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q44664

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose