Recombinant Bovine viral diarrhea virus Genome polyprotein, partial | CSB-BP312464BKX1

(No reviews yet) Write a Review
SKU:
CSB-BP312464BKX1
Availability:
3 - 7 Working Days
£354.40 - £848.00

Description

Recombinant Bovine viral diarrhea virus Genome polyprotein, partial | CSB-BP312464BKX1 | Cusabio

Alternative Name(s): NS5B

Gene Names: N/A

Research Areas: Others

Organism: Bovine viral diarrhea virus (strain SD-1) (BVDV) (Mucosal disease virus)

AA Sequence: MELITNELLYKTYKQKPVGVEEPVYDQAGNPLFGERGAIHPQSTLKLPHKRGERNVPTSLASLPKRGDCRSGNSKGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYICIDGCITVKSATRSHQRVLRWVHNRLDCPLWVTSC

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-168aa

Sequence Info: Partial

MW: 21.4

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Initial binding to target cell probably involves interaction of E with glycosaminoglycans. E1 and/or E2 are responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis.

Reference: "Molecular cloning and nucleotide sequence of a pestivirus genome, noncytopathic bovine viral diarrhea virus strain SD-1." Deng R., Brock K.V. Virology 191:867-869(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q01499

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose