Recombinant Blattella germanica Glutathione S-transferase | CSB-YP522732BTL

(No reviews yet) Write a Review
SKU:
CSB-YP522732BTL
Availability:
25 - 35 Working Days
  • Recombinant Blattella germanica Glutathione S-transferase
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €1,345.00

Description

Recombinant Blattella germanica Glutathione S-transferase | CSB-YP522732BTL | Cusabio

Alternative Name(s): GST class-sigma Major allergen Bla g 5 Allergen: Bla g 5

Gene Names: N/A

Research Areas: Metabolism

Organism: Blattella germanica (German cockroach) (Blatta germanica)

AA Sequence: APSYKLTYCPVKALGEPIRFLLSYGEKDFEDYRFQEGDWPNLKPSMPFGKTPVLEIDGKQTHQSVAISRYLGKQFGLSGKDDWENLEIDMIVDTISDFRAAIANYHYDADENSKQKKWDPLKKETIPYYTKKFDEVVKANGGYLAAGKLTWADFYFVAILDYLNHMAKEDLVANQPNLKALREKVLGLPAIKAWVAKRPPTDL

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-204aa

Sequence Info: Full Length of Mature Protein

MW: 25.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: RX + glutathione = HX + R-S-glutathione.

Reference: "Induction of IgE antibody responses by glutathione S-transferase from the German cockroach (Blattella germanica)."Arruda L.K., Vailes L.D., Platts-Mills T.A.E., Hayden M.L., Chapman M.D.J. Biol. Chem. 272:20907-20912(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: GST superfamily, Sigma family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O18598

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose