Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry1Ab (cry1Ab), partial | CSB-YP363358BDC

(No reviews yet) Write a Review
SKU:
CSB-YP363358BDC
Availability:
3 - 7 Working Days
  • Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry1Ab (cry1Ab), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$459.60 - $2,427.60

Description

Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein Cry1Ab (cry1Ab), partial | CSB-YP363358BDC | Cusabio

Alternative Name(s): 130KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(b)

Gene Names: cry1Ab

Research Areas: Others

Organism: Bacillus thuringiensis subsp. kurstaki

AA Sequence: HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1022-1155aa

Sequence Info: Partial

MW: 17.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Reference: Characterization of Bacillus thuringiensis subsp. kurstaki strain S93 effective against the Fall armyworm, Spodoptera frugiperda and cloning of a cry1Ab gene.Silva-Werneck J.O., De-Souza M.T., Dias J.M.C.S., Ribeiro B.M.Can. J. Microbiol. 45:464-471(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Involvement in disease:

Subcellular Location:

Protein Families: Delta endotoxin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0A370

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose