Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac (cry1Ac), partial | CSB-EP356448BDC

Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ac (cry1Ac), partial | CSB-EP356448BDC | Cusabio

Alternative Name(s): 133KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(c)

Gene Names: cry1Ac

Research Areas: Others

Organism: Bacillus thuringiensis subsp. kurstaki

AA Sequence: LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 972-1178aa

Sequence Info: Partial

MW: 50.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Reference: Characterized full-length and truncated plasmid clones of the crystal protein of Bacillus thuringiensis subsp. kurstaki HD-73 and their toxicity to Manduca sexta.Adang M.J., Staver M.J., Rocheleau T.A., Leighton J., Barker R.F., Thompson D.V.Gene 36:289-300(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Involvement in disease:

Subcellular Location:

Protein Families: Delta endotoxin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P05068

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A