Recombinant Autographa californica nuclear polyhedrosis virus Viral cathepsin (VCATH) | CSB-EP340730ARA

Recombinant Autographa californica nuclear polyhedrosis virus Viral cathepsin (VCATH) | CSB-EP340730ARA | Cusabio

Alternative Name(s): Cysteine proteinase Short name: CP

Gene Names: VCATH

Research Areas: Others

Organism: Autographa californica nuclear polyhedrosis virus (AcMNPV)

AA Sequence: PLEFDWRRLNKVTSVKNQGMCGACWAFATLASLESQFAIKHNQLINLSEQQMIDCDFVDAGCNGGLLHTAFEAIIKMGGVQLESDYPYEADNNNCRMNSNKFLVQVKDCYRYITVYEEKLKDLLRLVGPIPMAIDAADIVNYKQGIIKYCFNSGLNHAVLLVGYGVENNIPYWTFKNTWGTDWGEDGFFRVQQNINACGMRNELASTAVIY

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 113-323aa

Sequence Info: Full Length of Mature Protein

MW: 39.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. May participate in the degradation of foreign protein expressed by the baculovirus system (By similarity).

Reference: "The baculovirus Autographa californica nuclear polyhedrosis virus genome includes a papain-like sequence."Rawlings N.D., Pearl L.H., Buttle D.J.Biol. Chem. Hoppe-Seyler 373:1211-1215(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. Accumulates within infected cells as an inactive proenzyme (proV-CATH), which is activated by proteolytic cleavage upon cell death.

Involvement in disease:

Subcellular Location: Host endoplasmic reticulum

Protein Families: Peptidase C1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P25783

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A