Recombinant Arachis hypogaea Conglutin-7 | CSB-EP757666ANE

Recombinant Arachis hypogaea Conglutin-7 | CSB-EP757666ANE | Cusabio

Alternative Name(s): Conglutin-7; 2S protein 1; Seed storage protein SSP1; Seed storage protein SSP2; allergen Ara h 2

Gene Names: N/A

Research Areas: Others

Organism: Arachis hypogaea (Peanut)

AA Sequence: RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-172aa

Sequence Info: Full Length of Mature Protein

MW: 22 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Weak inhibitor of trypsin.

Reference: Isolation and molecular characterization of the first genomic clone of a major peanut allergen, Ara h 2.Viquez O.M., Summer C.G., Dodo H.W.J. Allergy Clin. Immunol. 107:713-717(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Weak inhibitor of trypsin.

Involvement in disease:

Subcellular Location:

Protein Families: 2S seed storage albumins family

Tissue Specificity: Expressed in seeds, not expressed in leaves, roots and pegs.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6PSU2

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A