Cusabio Arachis hypogaea Recombinants
Recombinant Arachis hypogaea Arachin Ahy-3, partial | CSB-YP737391ANE
- SKU:
- CSB-YP737391ANE
- Availability:
- 25 - 35 Working Days
Description
Recombinant Arachis hypogaea Arachin Ahy-3, partial | CSB-YP737391ANE | Cusabio
Alternative Name(s): Arachin Ahy-3 [Cleaved into: Arachin Ahy-3 chain alpha; Arachin Ahy-3 chain beta]
Gene Names: N/A
Research Areas: Others
Organism: Arachis hypogaea (Peanut)
AA Sequence: GIEETICTATVKMNIGKSTSADIYNPQAGSVRTVNELDLPILNRLGLSAEYGSIHRDAMFVPHYNMNANSMIYALHGGAHVQVVDCNGNRVFDEELQEGQSLVVPQNFAVAAKSQSEHFLYVAFKTNSRASISNLAGKNSYMWNLPEDVVANSYGLQYEQARQLKNNNPFTFLVPPQDSQ
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 299-478aa
Sequence Info: Partial
MW: 21.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: Isolation of peanut genes encoding arachins and conglutins by expressed sequence tags.Yan Y.-S., Lin X.-D., Zhang Y.-S., Wang L., Wu K., Huang S.-Z.Plant Sci. 169:439-445(2005)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families: 11S seed storage protein (globulins) family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q647H2
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A