Recombinant Arabidopsis thaliana Defensin-like protein 16 (PDF1.2A) | CSB-EP887761DOA

Recombinant Arabidopsis thaliana Defensin-like protein 16 (PDF1.2A) | CSB-EP887761DOA | Cusabio

Alternative Name(s): Low-molecular-weight cysteine-rich protein 77

Gene Names: PDF1.2A

Research Areas: others

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: QKLCEKPSGTWSGVCGNSNACKNQCINLEGAKHGSCNYVFPAHKCICYVPC

Source: E.coli

Tag Info: Tag-Free

Expression Region: 30-80aa

Sequence Info: Full Length of Mature Protein

MW: 5.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Confers broad-spectrum resistance to pathogens. Has antifungal activity in vitro.

Reference: "Molecular responses to aphid feeding in Arabidopsis in relation to plant defense pathways." Moran P.J., Thompson G.A. Plant Physiol. 125:1074-1085(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9FI23

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A