null

Recombinant Arabidopsis thaliana EPIDERMAL PATTERNING FACTOR-like protein 9 (EPFL9) | CSB-YP879855DOA

(No reviews yet) Write a Review
SKU:
CSB-YP879855DOA
Availability:
25 - 35 Working Days
€383.00 - €1,345.00
Frequently bought together:

Description

Recombinant Arabidopsis thaliana EPIDERMAL PATTERNING FACTOR-like protein 9 (EPFL9) | CSB-YP879855DOA | Cusabio

Alternative Name(s): EPF-like protein 9

Gene Names: EPFL9

Research Areas: Cardiovascular

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 32-102aa

Sequence Info: Full Length of Mature Protein

MW: 10.2

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Stomagen: Positively regulates stomatal density and patterning. Acts by competing with EPF2 for the same receptors, ERECTA and TMM . Not cleaved by the protease CRSP .

Reference: "Araport11: a complete reannotation of the Arabidopsis thaliana reference genome." Cheng C.Y., Krishnakumar V., Chan A.P., Thibaud-Nissen F., Schobel S., Town C.D. Plant J. 89:789-804(2017)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9SV72

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose