Cusabio Virus & Bacteria Recombinants
Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595 | CSB-MP887932AKE
- SKU:
- CSB-MP887932AKE
- Availability:
- 3 - 7 Working Days
Description
Recombinant Anemonia sulcata GFP-like non-fluorescent chromoprotein FP595 | CSB-MP887932AKE | Cusabio
Alternative Name(s): asFP595
Gene Names: N/A
Research Areas: Bioluminescence
Organism: Anemonia sulcata (Mediterranean snakelocks sea anemone)
AA Sequence: MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSC
Source: Mammalian cell
Tag Info: C-terminal hFc-tagged
Expression Region: 1-62aa
Sequence Info: Full Length of Mature Protein
MW: 35.7
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Pigment protein that is intensely purple in color.
Reference: "Natural animal coloration can be determined by a nonfluorescent green fluorescent protein homolog." Lukyanov K.A., Fradkov A.F., Gurskaya N.G., Matz M.V., Labas Y.A., Savitsky A.P., Markelov M.L., Zaraisky A.G., Zhao X., Fang Y., Tan W., Lukyanov S.A. J. Biol. Chem. 275:25879-25882(2000)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9GZ28
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A