Recombinant Anemonia sulcata Delta-actitoxin-Avd1c | CSB-YP355673AKE

(No reviews yet) Write a Review
SKU:
CSB-YP355673AKE
Availability:
3 - 7 Working Days
  • Recombinant Anemonia sulcata Delta-actitoxin-Avd1c
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €2,023.00

Description

Recombinant Anemonia sulcata Delta-actitoxin-Avd1c | CSB-YP355673AKE | Cusabio

Alternative Name(s): ATX-II

Gene Names: N/A

Research Areas: Others

Organism: Anemonia sulcata (Mediterranean snakelocks sea anemone)

AA Sequence: GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-47aa

Sequence Info: Full Length

MW: 6.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds specifically to voltage-gated sodium channels (Nav) (site 3), thereby delaying their inactivation. Has a strong effect on crustaceans and insects (DmNav1) and a weaker effect on mammals. This toxin is highly potent at mammalian Nav1.1/SCN1A (EC(50)=6.01 nM) and Nav1.2/SCN2A (EC(50)=7.88 nM) (PubMed:15169781). It has also great activity on Nav1.5/SCN5A (EC(50)=49.05 nM), Nav1.4/SCN4A (EC(50)=109.49 nM) and Nav1.6/SCN8A (EC(50)=about 180 nM) and is less potent on Nav1.3/SCN3A (EC(50)=759.22 nM) (when measured as the increase in the slow component) (PubMed:15169781).

Reference: "Anemonia sulcata toxins modify activation and inactivation of Na+ currents in a crayfish neurone."Hartung K., Rathmayer W.Pflugers Arch. 404:119-125(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds specifically to voltage-gated sodium channels (Nav) (site 3), thereby delaying their inactivation. Has a strong effect on crustaceans and insects (DmNav1) and a weaker effect on mammals. This toxin is highly potent at mammalian Nav1.1/SCN1A (EC(50)=6.01 nM) and Nav1.2/SCN2A (EC(50)=7.88 nM)

Involvement in disease:

Subcellular Location: Secreted, Nematocyst

Protein Families: Sea anemone sodium channel inhibitory toxin family, Type I subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01528

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose