null

Recombinant Amylomyces rouxii Chitin deacetylase | CSB-EP344641AJI

(No reviews yet) Write a Review
SKU:
CSB-EP344641AJI
Availability:
3 - 7 Working Days
€352.00 - €1,702.00
Frequently bought together:

Description

Recombinant Amylomyces rouxii Chitin deacetylase | CSB-EP344641AJI | Cusabio

Alternative Name(s): Chitin deacetylase; EC 3.5.1.41

Gene Names: N/A

Research Areas: Others

Organism: Amylomyces rouxii(Filamentous fungus)(Mucor rouxii)

AA Sequence: DTSANYWQSFTSQINPKNISIPSIEQTSSIDPTQECAYYTPDASLFTFNASEWPSIWEVATTNGMNESAEFLSVYNSIDWTKAPNISVRTLDANGNLDTTGYNTATDPDCWWTATTCTSPKISDINDDISKCPEPETWGLTYDDGPNCSHNAFYDYLQEQKLKASMFYIGSNVVDWPYGAMRGVVDGHHIASHTWSHPQMTTKTNQEVLAEFYYTQKAIKLATGLTPRYWRPPYGDIDDRVRWIASQLGLTAVIWNLDTDDWSAGVTTTVEAVEQSYSDYIAMGTNGTFANSGNIVLTHEINTTMSLAVENLPKIISAYKQVIDVATCYNISHPYFEDYEWTNVLNGTKSSATASGSATSASASGGATTAAAHIQASTSGAMSVLPNLALISAFIATLLF

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 22-421aa

Sequence Info: Full Length of Mature Protein

MW: 49.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Hydrolyzes the N-acetamido groups of N-acetyl-D-glucosamine residues in chitin. This enzyme specifically acts on beta-1-4-linked N-acetylglucosamine homopolymers and requires at least 4 residues for catalysis.

Reference: "The primary structure of a fungal chitin deacetylase reveals the function for two bacterial gene products." Kafetzopoulos D., Thireos G., Vournakis J.N., Bouriotis V. Proc. Natl. Acad. Sci. U.S.A. 90:8005-8008(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P50325

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose