Recombinant Alternaria alternata Major allergen Alt a 1 (ALTA1) | CSB-YP303588AZV

Recombinant Alternaria alternata Major allergen Alt a 1 (ALTA1) | CSB-YP303588AZV | Cusabio

Alternative Name(s): Allergen: Alt a 1

Gene Names: ALTA1

Research Areas: Others

Organism: Alternaria alternata (Alternaria rot fungus) (Torula alternata)

AA Sequence: APLESRQDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 19-157aa

Sequence Info: Full Length of Mature Protein

MW: 17.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Isolation and expression of a cDNA clone encoding an Alternaria alternata Alt a 1 subunit.De Vouge M.W., Thaker A.J., Curran I.H., Zhang L., Muradia G., Rode H., Vijay H.M.Int. Arch. Allergy Immunol. 111:385-395(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted

Protein Families: ALTA1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P79085

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A