Rattus norvegicus Recombinant

Recombinant Rat Trypsin-4 (Try4) | CSB-YP319450RAa4 | CusabioAlternative Name(s): Pretrypsinogen IV Trypsin IVGene Names: Try4Research Areas: Cell BiologyOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Trypsin-4 (Try4) | CSB-YP319450RA | CusabioAlternative Name(s): Pretrypsinogen IV Trypsin IVGene Names: Try4Research Areas: Cell BiologyOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Oncomodulin (Ocm) | CSB-YP016264RA | CusabioAlternative Name(s): Parvalbumin betaGene Names: OcmResearch Areas: othersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Myosin-binding protein C, cardiac-type (Mybpc3), partial | CSB-YP015267RA | CusabioAlternative Name(s): C-protein, cardiac muscle isoformGene Names: Mybpc3Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Multiple inositol polyphosphate phosphatase 1 (Minpp1) | CSB-YP013831RA | CusabioAlternative Name(s): 2,3-bisphosphoglycerate 3-phosphatase (EC:3.1.3.80) ;2,3-BPG phosphataseInositol (1,3,4,5)-tetrakisphosphate 3-phosphatase...

Recombinant Rat High mobility group protein B1 (Hmgb1) | CSB-YP010553RAa1 | CusabioAlternative Name(s): High mobility group protein 1?HMG-1?Gene Names: Hmgb1Research Areas: Epigenetics and Nuclear SignalingOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Glypican-3 (Gpc3), partial | CSB-YP009705RA | CusabioAlternative Name(s): Intestinal protein OCI-5Gene Names: Gpc3Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Ephrin-A1 (Efna1) | CSB-YP007460RA | CusabioAlternative Name(s): EPH-related receptor tyrosine kinase ligand 1 ;LERK-1Immediate early response protein B61Gene Names: Efna1Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Dipeptidyl aminopeptidase-like protein 6 (DPP6), partial | CSB-YP007140RA | CusabioAlternative Name(s): DPPXDipeptidyl aminopeptidase-related proteinDipeptidyl peptidase 6Dipeptidyl peptidase IV-like proteinDipeptidyl peptidase VI ;DPP...

Recombinant Rat Collagen alpha-1 (I) chain, partial | CSB-YP005727RA | CusabioAlternative Name(s): Alpha-1 type I collagenGene Names: Col1a1Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Complement factor D (Cfd) | CSB-YP005271RA | CusabioAlternative Name(s): Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor DGene Names: CfdResearch Areas: ImmunologyOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Carbonic anhydrase 1 (Ca1) | CSB-YP004364RA | CusabioAlternative Name(s): Carbonate dehydratase IGene Names: Ca1Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Angiopoietin-1 (Angpt1) | CSB-YP001706RA | CusabioAlternative Name(s): Angpt1Angiopoietin-1; ANG-1Gene Names: Angpt1Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Intestinal-type alkaline phosphatase 1 (Alpi) | CSB-YP001627RA | CusabioAlternative Name(s): Intestinal-type alkaline phosphatase 1(IAP-1)(Intestinal alkaline phosphatase 1)(EC 3.1.3.1)(Intestinal alkaline phosphatase I)(IAP-I)Gene Names:...

Recombinant Rat Allograft inflammatory factor 1 (Aif1) | CSB-YP001490RA | CusabioAlternative Name(s): Ionized calcium-binding adapter molecule 1 MRF-1 Microglia response factorGene Names: Aif1Research Areas: NeuroscienceOrganism: Rattus norvegicus...

Recombinant Rat Type-2 angiotensin II receptor (Agtr2), partial | CSB-YP001466RA | CusabioAlternative Name(s): Angiotensin II type-2 receptor ;AT2Gene Names: Agtr2Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Interleukin-18 (Il18) | CSB-RP176194r | CusabioAlternative Name(s): Interferon gamma-inducing factor ;IFN-gamma-inducing factorInterleukin-1 gamma ;IL-1 gammaGene Names: Il18Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA...

Recombinant Rat Haptoglobin (Hp), partial | CSB-RP170694r | CusabioAlternative Name(s): Liver regeneration-related protein LRRG173ZonulinGene Names: HPResearch Areas: Epigenetics and Nuclear SignalingOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Beta-nerve growth factor (Ngf), Partial | CSB-RP168594r | CusabioAlternative Name(s): Ngf; Ngfb; Beta-nerve growth factor; Beta-NGFGene Names: NgfResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Metalloproteinase inhibitor 1 (Timp1) | CSB-RP167194r | CusabioAlternative Name(s): Tissue inhibitor of metalloproteinases 1 ;TIMP-1Gene Names: Timp1Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Brain-derived neurotrophic factor (Bdnf), partial | CSB-RP166394r | CusabioAlternative Name(s): BdnfBrain-derived neurotrophic factor; BDNF) [Cleaved into: BDNF precursor form; ProBDNF)]Gene Names: BdnfResearch Areas: OthersOrganism:...

Recombinant Rat Nitric oxide synthase, endothelial (Nos3), partial | CSB-RP165794r(A3) | CusabioAlternative Name(s): Constitutive NOS ;cNOSEC-NOSEndothelial NOS ;eNOSNOS type III ;NOSIIIGene Names: Nos3 Research Areas: OthersOrganism: Rattus norvegicus...

Recombinant Rat Vasopressin V1b receptor (Avpr1b), partial | CSB-RP156394r(A4) | CusabioAlternative Name(s): AVPR V1bAVPR V3Antidiuretic hormone receptor 1bVasopressin V3 receptorGene Names: Avpr1bResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA...

Recombinant Rat Vasopressin V1a receptor (Avpr1a), partial | CSB-RP156244r | CusabioAlternative Name(s): AVPR V1aAntidiuretic hormone receptor 1aVascular/hepatic-type arginine vasopressin receptorGene Names: Avpr1aResearch Areas: OthersOrganism: Rattus...

Recombinant Rat GTPase HRas (Hras) | CSB-RP155374r | CusabioAlternative Name(s): H-Ras-1Transforming protein p21c-H-rasp21rasGene Names: HrasResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Retinoblastoma-associated protein (Rb1), partial | CSB-RP155294r(A3) | CusabioAlternative Name(s): pRb ;Rbpp105Gene Names: Rb1Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Cellular tumor antigen p53 (Tp53) | CSB-RP155094r | CusabioAlternative Name(s): Tumor suppressor p53Gene Names: Tp53Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Vesicle-fusing ATPase (Nsf), partial | CSB-RP154574r(N) | CusabioAlternative Name(s): N-ethylmaleimide-sensitive fusion protein ;NEM-sensitive fusion proteinVesicular-fusion protein NSFGene Names: NsfResearch Areas: OthersOrganism: Rattus...

Recombinant Rat Chemokine (C-X-C motif) ligand 13 (CXCL13), partial | CSB-RP079044r | CusabioAlternative Name(s): /Gene Names: CXCL13Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Thrombopoietin (Thpo), partial | CSB-RP076444r | CusabioAlternative Name(s): Thpo; ThrombopoietinGene Names: ThpoResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Chitinase-3-like protein 1 (Chi3l1) | CSB-EP893408RAb1 | CusabioAlternative Name(s): Cartilage glycoprotein 39 (CGP-39) (GP-39)Gene Names: Chi3l1Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Chitinase-3-like protein 1 (Chi3l1) | CSB-EP893408RA | CusabioAlternative Name(s): Cartilage glycoprotein 39Gene Names: Chi3l1Research Areas: Signal TransductionOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Inducible T-cell costimulator (Icos), partial | CSB-EP889939RA | CusabioAlternative Name(s): Activation-inducible lymphocyte immunomediatory molecule CD_antigen: CD278Gene Names: IcosResearch Areas: ImmunologyOrganism: Rattus norvegicus...

Recombinant Rat Cyclic AMP-dependent transcription factor ATF-4 (Atf4) | CSB-EP880648RA | CusabioAlternative Name(s): Activating transcription factor 4Gene Names: Atf4Research Areas: TranscriptionOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat COMM domain-containing protein 5 (Commd5) | CSB-EP880645RA | CusabioAlternative Name(s): Hypertension-related calcium-regulated gene protein (HCaRG)Gene Names: Commd5Research Areas: Epigenetics and Nuclear SignalingOrganism: Rattus...

Recombinant Rat E3 ubiquitin-protein ligase parkin (Park2) | CSB-EP864348RAb1 | CusabioAlternative Name(s): Parkin RBR E3 ubiquitin-protein ligase (Park2)Gene Names: Park2Research Areas: Cell BiologyOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Interleukin-11 (Il11) | CSB-EP859561RA | CusabioAlternative Name(s): IL-11Gene Names: Il11Research Areas: CancerOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Sclerostin (Sost) | CSB-EP859165RA | CusabioAlternative Name(s): Sost; SclerostinGene Names: SostResearch Areas: Stem CellsOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat E3 ubiquitin-protein ligase TRIM63 (Trim63) | CSB-EP856332RA | CusabioAlternative Name(s): Muscle-specific RING finger protein 1 RING-type E3 ubiquitin transferase TRIM63 Tripartite motif-containing protein 63Gene Names: Trim63Research...

Recombinant Rat Netrin-1 (Ntn1) | CSB-EP849759RA | CusabioAlternative Name(s): /Gene Names: Ntn1Research Areas: NeuroscienceOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat NAD-dependent protein deacetylase (Sirt3) | CSB-EP848095RA | CusabioAlternative Name(s): /Gene Names: Sirt3Research Areas: Epigenetics and Nuclear SignalingOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Cryptochrome-2 (Cry2) | CSB-EP842112RAb3 | CusabioAlternative Name(s): Cry2Cryptochrome-2Gene Names: Cry2Research Areas: CardiovascularOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial (Etfdh) | CSB-EP740908RA | CusabioAlternative Name(s): Electron-transferring-flavoprotein dehydrogenaseGene Names: EtfdhResearch Areas: MetabolismOrganism: Rattus...

Recombinant Rat Gamma-synuclein (Sncg) | CSB-EP737203RA | CusabioAlternative Name(s): Persyn Sensory neuron synucleinGene Names: SncgResearch Areas: NeuroscienceOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat FAD-linked sulfhydryl oxidase ALR (Gfer) | CSB-EP733907RA | CusabioAlternative Name(s): Augmenter of liver regenerationGene Names: GferResearch Areas: Signal TransductionOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Cytochrome P450 1B1 (Cyp1b1) | CSB-EP731067RA | CusabioAlternative Name(s): CYPIB1 Cytochrome P450RAPGene Names: Cyp1b1Research Areas: MetabolismOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Lysosomal acid lipase/cholesteryl ester hydrolase (Lipa) | CSB-EP731032RA | CusabioAlternative Name(s): Cholesteryl esterase ?Lipase A? ?Sterol esterase?Gene Names: LipaResearch Areas: MetabolismOrganism: Rattus norvegicus (Rat)AA...

Recombinant Rat Oncostatin-M (Osm) | CSB-EP723970RAb0 | CusabioAlternative Name(s): OSMGene Names: OsmResearch Areas: ImmunologyOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Ribosyldihydronicotinamide dehydrogenase [quinone] (Nqo2) | CSB-EP721470RA | CusabioAlternative Name(s): NRH dehydrogenase [quinone] 2NRH:quinone oxidoreductase 2Quinone reductase 2 ;QR2Gene Names: Nqo2Research Areas: OthersOrganism:...

Recombinant Rat Calcium calmodulin-dependent 3, 5 cyclic nucleotide phosphodiesterase 1C (Pde1c) | CSB-EP720512RA | CusabioAlternative Name(s): Cam-PDE 1C;3',5'-cyclic-AMP phosphodiesterase (EC:3.1.4.-By similarity);3',5'-cyclic-GMP phosphodiesteraseGene...

Recombinant Rat Meteorin-like protein (Metrnl) | CSB-EP719323RA | CusabioAlternative Name(s): SubfatinGene Names: MetrnlResearch Areas: Cell BiologyOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Beta-synuclein (Sncb) | CSB-EP717413RA | CusabioAlternative Name(s): Beta-synuclein(Phosphoneuroprotein 14)(PNP 14)Gene Names: SncbResearch Areas: NeuroscienceOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Semaphorin-3A (Sema3a) | CSB-EP717391RA | CusabioAlternative Name(s): Semaphorin III Short name:Sema IIIGene Names: Sema3aResearch Areas: CardiovascularOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Disks large homolog 3 (Dlg3) | CSB-EP717292RA | CusabioAlternative Name(s): PSD-95/SAP90-related protein 1Synapse-associated protein 102 ;SAP-102 ;SAP102Gene Names: Dlg3Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Myosin-9 (Myh9), partial | CSB-EP717285RA | CusabioAlternative Name(s): Cellular myosin heavy chain, type A Myosin heavy chain 9 Myosin heavy chain, non-muscle IIa Non-muscle myosin heavy chain A Non-muscle myosin heavy chain IIaGene...

Recombinant Rat Caprin-1 (Caprin1) | CSB-EP711733RA | CusabioAlternative Name(s): Cytoplasmic domain activation- and proliferation-associated protein 1;GPI-anchored protein p137 ;GPI-p137 ;p137GPIRNA granule protein 105Gene Names: Caprin1Research Areas:...

Recombinant Rat 17-beta-hydroxysteroid dehydrogenase 13 (Hsd17b13) | CSB-EP711723RA | CusabioAlternative Name(s): Short-chain dehydrogenase/reductase 9 (17-beta-HSD 13) (Scdr9)Gene Names: Hsd17b13Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA...

Recombinant Rat CMRF35-like molecule 1 (Cd300lf), Partial | CSB-EP707077RA | CusabioAlternative Name(s): CD300 antigen-like family member F CD_antigen: CD300fGene Names: Cd300lfResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Putative phospholipase B-like 2 (Plbd2) | CSB-EP683927RA | CusabioAlternative Name(s): LAMA-like protein 2Lamina ancestor homolog 2;Phospholipase B domain-containing protein 2Gene Names: Plbd2Research Areas: OthersOrganism: Rattus...

Recombinant Rat Zinc transporter ZIP13 (Slc39a13), partial | CSB-EP644804RA | CusabioAlternative Name(s): Solute carrier family 39 member 13Zrt- and Irt-like protein 13 ;ZIP-13Gene Names: Slc39a13Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA...

Recombinant Rat Insulin-like growth factor I (Igf1) | CSB-EP362300RA | CusabioAlternative Name(s): SomatomedinGene Names: Igf1Research Areas: Signal TransductionOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Serine protease inhibitor A3K (Serpina3k) | CSB-EP361549RA | CusabioAlternative Name(s): CPI-21 ?Contrapsin-like protease inhibitor 1? ?GHR-P63? ?Growth hormone-regulated proteinase inhibitor??Kallikrein-binding protein? (KBP) (SPI-2.3)...

Recombinant Rat Alpha-1-acid glycoprotein (Orm1) | CSB-EP360882RAa0 | CusabioAlternative Name(s): Orosomucoid ?OMD?Gene Names: Orm1Research Areas: CardiovascularOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Alpha-1-acid glycoprotein (Orm1) | CSB-EP360882RA | CusabioAlternative Name(s): Orosomucoid (OMD)Gene Names: Orm1Research Areas: CardiovascularOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Mast cell protease 2 (Mcpt2) | CSB-EP360441RA | CusabioAlternative Name(s): Group-specific protease Mast cell protease IIGene Names: Mcpt2Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Insulin-1 (Ins1), partial | CSB-EP355622RA | CusabioAlternative Name(s): Ins-1Gene Names: Ins1Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence: FVKQHLCGPHLVEALYLVCGERGFFYTPKSSource: E.coliTag Info: N-terminal...

Recombinant Rat Thyroxine 5-deiodinase (Dio3), partial (170:U?missing) | CSB-EP344617RA | CusabioAlternative Name(s): 5DIIIDIOIIIType 3 DIType-III 5'-deiodinaseGene Names: Dio3Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Troponin T, cardiac muscle (Tnnt2) | CSB-EP341903RA | CusabioAlternative Name(s): Cardiac muscle troponin TGene Names: Tnnt2Research Areas: BiochemicalsOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Regenerating islet-derived protein 3-beta (Reg3b) | CSB-EP326510RA | CusabioAlternative Name(s): Pancreatitis-associated protein 1;Peptide 23REG-2Regenerating islet-derived protein III-beta ;Reg III-betaGene Names: Reg3bResearch Areas:...

Recombinant Rat Phospholipase A2, membrane associated (Pla2g2a) | CSB-EP321246RA | CusabioAlternative Name(s): GIIC sPLA2Group IIA phospholipase A2;Phosphatidylcholine 2-acylhydrolase 2AGene Names: Pla2g2aResearch Areas: OthersOrganism: Rattus norvegicus...

Recombinant Rat Trypsin-4 (Try4) | CSB-EP319450RA | CusabioAlternative Name(s): Pretrypsinogen IV Trypsin IVGene Names: Try4Research Areas: Cell BiologyOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Caprin family member 2 (Caprin2), partial | CSB-EP2482RA | CusabioAlternative Name(s): LOC686779Gene Names: Caprin2Research Areas: Cell BiologyOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Vascular endothelial growth factor A (Vegfa) | CSB-EP025833RA | CusabioAlternative Name(s): Vascular permeability factor ;VPFGene Names: VegfaResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Vascular cell adhesion protein 1 (Vcam1), partial | CSB-EP025809RA1 | CusabioAlternative Name(s): CD106Gene Names: Vcam1Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Vesicle-associated membrane protein 2 (Vamp2), partial | CSB-EP025781RA1 | CusabioAlternative Name(s): Vamp2; Syb2; Vesicle-associated membrane protein 2; VAMP-2; Synaptobrevin-2Gene Names: Vamp2Research Areas: CancerOrganism: Rattus...

Recombinant Rat Thyrotropin subunit beta (Tshb) | CSB-EP025130RA | CusabioAlternative Name(s): Thyroid-stimulating hormone subunit betaGene Names: TshbResearch Areas: Signal TransductionOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Tryptase (Tpsab1) | CSB-EP024127RA | CusabioAlternative Name(s): Mast cell protease 7Gene Names: Tpsab1Research Areas: ImmunologyOrganism: Rattus norvegicus (Rat) AA Sequence:...

Recombinant Rat Trophoblast glycoprotein (Tpbg), partial | CSB-EP024093RA | CusabioAlternative Name(s): 5T4 oncofetal trophoblast glycoprotein Short name: 5T4 oncotrophoblast glycoprotein Wnt-activated inhibitory factor 1 Short name: WAIF1Gene Names:...

Recombinant Rat TGF-beta receptor type-2 (Tgfbr2), partial | CSB-EP023452RA1 | CusabioAlternative Name(s): TGF-beta type II receptor (Transforming growth factor-beta receptor type II) (TGF-beta receptor type II) (TbetaR-II) (TGFR-2)Gene Names:...

Recombinant Rat Transforming growth factor beta-1 proprotein (Tgfb1), partial | CSB-EP023446RAe1 | CusabioAlternative Name(s): Tgfb1; Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide; LAP); Transforming growth factor...

Recombinant Rat Transforming growth factor beta-1 proprotein (Tgfb1), partial | CSB-EP023446RAa0 | CusabioAlternative Name(s): Tgfb1; Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide; LAP); Transforming growth factor...