null

Recombinant Rat Carbonic anhydrase 1 (Ca1) | CSB-YP004364RA

(No reviews yet) Write a Review
SKU:
CSB-YP004364RA
Availability:
25 - 35 Working Days
  • Recombinant Rat Carbonic anhydrase 1 (Ca1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,708.00
Frequently bought together:

Description

Recombinant Rat Carbonic anhydrase 1 (Ca1) | CSB-YP004364RA | Cusabio

Alternative Name(s): Carbonate dehydratase I

Gene Names: Ca1

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-261aa

Sequence Info: Full Length of Mature Protein

MW: 30.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Reversible hydration of carbon dioxide

Reference: Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Proteome profile of the mature rat olfactory bulb.Maurya D.K., Sundaram C.S., Bhargava P.Proteomics 9:2593-2599(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Reversible hydration of carbon dioxide.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Alpha-carbonic anhydrase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: B0BNN3

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose