Human Recombinant

Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (SDHA), partial | CSB-EP020903HU1a0 | CusabioAlternative Name(s): Flavoprotein subunit of complex II ;FpGene Names: SDHAResearch Areas: TransportOrganism: Homo...

Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (SDHA), partial | CSB-EP020903HU1 | CusabioAlternative Name(s): Flavoprotein subunit of complex II ;FpGene Names: SDHAResearch Areas: TransportOrganism: Homo...

Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (SDHA), partial | CSB-EP020903HU | CusabioAlternative Name(s): Flavoprotein subunit of complex II ;FpGene Names: SDHAResearch Areas: TransportOrganism: Homo...

Recombinant Human Stromal cell-derived factor 2 (SDF2) | CSB-EP020900HU | CusabioAlternative Name(s): SDF2Stromal cell-derived factor 2; SDF-2Gene Names: SDF2Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Syndecan-1 (SDC1), partial | CSB-EP020888HU | CusabioAlternative Name(s): CD138Gene Names: SDC1Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Non-specific lipid-transfer protein (SCP2) | CSB-EP020856HU | CusabioAlternative Name(s): Propanoyl-CoA C-acyltransferase;SCP-chiSCPXSterol carrier protein 2 ;SCP-2Sterol carrier protein X ;SCP-XGene Names: SCP2Research Areas:...

Recombinant Human Protein SCO2 homolog, mitochondrial (SCO2) | CSB-EP020853HU | CusabioAlternative Name(s): Cytochrome oxidase deficient homolog 2; MGC125823; MGC125825; OTTHUMP00000196774; OTTHUMP00000196775; Protein SCO2 homolog; mitochondrial; SCO...

Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A), partial | CSB-EP020834HU | CusabioAlternative Name(s): Sodium channel protein brain I subunit alpha;Sodium channel protein type I subunit alpha;Voltage-gated sodium channel subunit...

Recombinant Human Uteroglobin (SCGB1A1) | CSB-EP020811HU | CusabioAlternative Name(s): Clara cell phospholipid-binding protein;CCPBP;Clara cells 10 kDa secretory protein;CC10;Secretoglobin family 1A member 1;Urinary protein 1;UP-1;UP1;Urine protein 1Gene...

Recombinant Human Secretogranin-2 (SCG2), partial | CSB-EP020808HU1 | CusabioAlternative Name(s): Chromogranin-C;Secretogranin II;SgII;Secretoneurin;SN;ManserinGene Names: SCG2Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human SCAN domain-containing protein 1 (SCAND1) | CSB-EP020755HU | CusabioAlternative Name(s): Leap1; Leucine rich domain interacting protein 1; Pgc2; PPAR gamma cofactor 2; Ppargc2; RAZ1; SCAN domain containing 1; SCAN domain containing...

Recombinant Human Diamine acetyltransferase 1 (SAT1), partial | CSB-EP020717HU1a0 | CusabioAlternative Name(s): Polyamine N-acetyltransferase 1;Putrescine acetyltransferase;Spermidine/spermine N(1)-acetyltransferase 1 ;SSAT ;SSAT-1Gene Names:...

Recombinant Human Diamine acetyltransferase 1 (SAT1), partial | CSB-EP020717HU1 | CusabioAlternative Name(s): Polyamine N-acetyltransferase 1;Putrescine acetyltransferase;Spermidine/spermine N(1)-acetyltransferase 1 ;SSAT ;SSAT-1Gene Names: SAT1Research...

Recombinant human Seryl-tRNA synthetase, Cytoplasmic domain protein (SERS), partial | CSB-EP020709HU1 | CusabioAlternative Name(s): Seryl-tRNA synthetase ;SerRSSeryl-tRNA(Ser/Sec) synthetaseGene Names: SERSResearch Areas: MetabolismOrganism: Homo sapiens...

Recombinant Human Protein S100-A6 (S100A6) | CSB-EP020634HU | CusabioAlternative Name(s): Calcyclin;Growth factor-inducible protein 2A9MLN 4Prolactin receptor-associated protein ;PRAS100 calcium-binding protein A6Gene Names: S100A6Research Areas:...

Recombinant Human Protein S100-A4 (S100A4) | CSB-EP020632HU | CusabioAlternative Name(s): Calvasculin;Metastasin;Placental calcium-binding protein;Protein Mts1S100 calcium-binding protein A4Gene Names: S100A4Research Areas: CardiovascularOrganism: Homo...

Recombinant Human Protein S100-A3 (S100A3) | CSB-EP020631HU | CusabioAlternative Name(s): Protein S-100E S100 calcium-binding protein A3Gene Names: S100A3Research Areas: Signal Transduction Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Protein S100-A12 (S100A12) | CSB-EP020626HU | CusabioAlternative Name(s): CGRP Calcium-binding protein in amniotic fluid 1Gene Names: S100A12Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Protein S100-A11 (S100A11) | CSB-EP020624HU | CusabioAlternative Name(s): Calgizzarin;Metastatic lymph node gene 70 protein ;MLN 70Protein S100-CS100 calcium-binding protein A11Gene Names: S100A11Research Areas: Signal...

Recombinant Human Protein S100-A10 (S100A10) | CSB-EP020623HU | CusabioAlternative Name(s): Calpactin I light chain Calpactin-1 light chain Cellular ligand of annexin II S100 calcium-binding protein A10 p10 protein p11 ANX2LG, CAL1L, CLP11Gene Names:...

Recombinant Human Protein S100-A1 (S100A1) | CSB-EP020622HU | CusabioAlternative Name(s): S-100 protein alpha chain;S-100 protein subunit alpha;S100 calcium-binding protein A1Gene Names: S100A1Research Areas: Signal TransductionOrganism: Homo sapiens...

Recombinant Human Ryanodine receptor 3 (RYR3), partial | CSB-EP020621HU | CusabioAlternative Name(s): Brain ryanodine receptor-calcium release channelBrain-type ryanodine receptorType 3 ryanodine receptorGene Names: RYR3Research Areas:...

Recombinant Human Ryanodine receptor 1 (RYR1), partial | CSB-EP020619HU | CusabioAlternative Name(s): Skeletal muscle calcium release channelSkeletal muscle ryanodine receptorSkeletal muscle-type ryanodine receptorType 1 ryanodine receptorGene Names:...

Recombinant Human Runt-related transcription factor 3 (RUNX3) | CSB-EP020595HU | CusabioAlternative Name(s): Acute myeloid leukemia 2 protein Core-binding factor subunit alpha-3 Short name:CBF-alpha-3Gene Names: RUNX3Research Areas: Epigenetics and...

Recombinant Human Runt-related transcription factor 1 (Runx1) | CSB-EP020592HU | CusabioAlternative Name(s): Acute myeloid leukemia 1 protein (Core-binding factor subunit alpha-2) (CBF-alpha-2) (Oncogene AML-1) (Polyomavirus enhancer-binding protein 2...

Recombinant Human Retinoschisin (RS1) | CSB-EP020534HUe0 | CusabioAlternative Name(s): X-linked juvenile retinoschisis proteinGene Names: RS1Research Areas: Cell AdhesionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Retinoschisin (RS1) | CSB-EP020534HU | CusabioAlternative Name(s): X-linked juvenile retinoschisis proteinGene Names: RS1Research Areas: Cell AdhesionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ribonucleoside-diphosphate reductase subunit M2 (RRM2) | CSB-EP020519HU | CusabioAlternative Name(s): Ribonucleotide reductase small chainRibonucleotide reductase small subunitGene Names: RRM2Research Areas: TranscriptionOrganism: Homo...

Recombinant Human Ribonucleoside-diphosphate reductase large subunit (RRM1) | CSB-EP020518HU | CusabioAlternative Name(s): Ribonucleoside-diphosphate reductase subunit M1Ribonucleotide reductase large subunitGene Names: RRM1Research Areas: Epigenetics...

Recombinant Human Ras-related protein R-Ras2 (RRAS2) | CSB-EP020514HU | CusabioAlternative Name(s): Ras-like protein TC21 Teratocarcinoma oncogeneGene Names: RRAS2Research Areas: Signal Transduction Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Human 40S ribosomal protein SA (RPSA) | CSB-EP020485HUb1 | CusabioAlternative Name(s): 37 kDa laminin receptor precursor (37LRP) (37/67 kDa laminin receptor) (LRP/LR) (67 kDa laminin receptor) (67LR) (Colon carcinoma laminin-binding protein)...

Recombinant Human 40S ribosomal protein S6 (RPS6), partial | CSB-EP020463HU1 | CusabioAlternative Name(s): Phosphoprotein NP33 ?Small ribosomal subunit protein eS6?Gene Names: RPS6Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens...

Recombinant Human 40S ribosomal protein S3 (RPS3) | CSB-EP020443HUC7 | CusabioAlternative Name(s): Small ribosomal subunit protein uS3Gene Names: RPS3Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human 40S ribosomal protein S3 (RPS3) | CSB-EP020443HU | CusabioAlternative Name(s): 40S ribosomal protein S3; fb13d09; FLJ26283; FLJ27450; IMR 90 ribosomal protein S3; MGC56088; MGC87870; OTTHUMP00000229804; OTTHUMP00000229805;...

Recombinant Human 40S ribosomal protein S27 (RPS27) | CSB-EP020419HU | CusabioAlternative Name(s): Metallopan-stimulin 1Gene Names: RPS27Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human 40S ribosomal protein S18 (RPS18) | CSB-EP020385HU | CusabioAlternative Name(s): Ke-3 ;Ke3Gene Names: RPS18Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human 60S acidic ribosomal protein P2 (RPLP2) | CSB-EP020342HU | CusabioAlternative Name(s): Large ribosomal subunit protein P2 Renal carcinoma antigen NY-REN-44 D11S2243E, RPP2Gene Names: RPLP2Research Areas: CancerOrganism: Homo sapiens...

Recombinant Human 60S acidic ribosomal protein P1 (RPLP1) | CSB-EP020340HU | CusabioAlternative Name(s): 60S acidic ribosomal protein P1; RLA1_HUMAN; Rplp1Gene Names: RPLP1Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA...

Recombinant Human 60S acidic ribosomal protein P0 (RPLP0) | CSB-EP020336HU | CusabioAlternative Name(s): 60S ribosomal protein L10EGene Names: RPLP0Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human 60S ribosomal protein L9 (RPL9) | CSB-EP020326HU | CusabioAlternative Name(s): 60S ribosomal protein L9; DKFZp313J1510; FLJ27456; MGC15545; NPC A 16; Ribosomal protein L9; RL9_HUMAN; RPL9P7; RPL9P8; RPL9P9Gene Names: RPL9Research Areas:...

Recombinant Human 60S ribosomal protein L35a (RPL35A) | CSB-EP020248HU | CusabioAlternative Name(s): Cell growth-inhibiting gene 33 proteinGene Names: RPL35AResearch Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human 60S ribosomal protein L30 (RPL30) | CSB-EP020225HU | CusabioAlternative Name(s): 60S ribosomal protein L30; L30; Ribosomal protein L30; RL30_HUMAN; RPL30Gene Names: RPL30Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo...

Recombinant Human 60S ribosomal protein L29 (RPL29) | CSB-EP020219HU | CusabioAlternative Name(s): Cell surface heparin-binding protein HIP (Large ribosomal subunit protein eL29)Gene Names: RPL29Research Areas: Epigenetics and Nuclear SignalingOrganism:...

Recombinant Human 60S ribosomal protein L28 (RPL28) | CSB-EP020217HU | CusabioAlternative Name(s): 60S ribosomal protein L28; FLJ 43307 ; FLJ43307 ; L 28; L28; Ribosomal protein L28 ; RL28_HUMAN; RPL 28 ; rpl28Gene Names: RPL28Research Areas: Epigenetics...

Recombinant Human Replication protein A 14KDA subunit (RPA3), partial | CSB-EP020091HUe0 | CusabioAlternative Name(s): Replication factor A protein 3 ;RF-A protein 3Gene Names: RPA3Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens...

Recombinant Human Replication protein A 14KDA subunit (RPA3), partial | CSB-EP020091HU | CusabioAlternative Name(s): Replication factor A protein 3 ;RF-A protein 3Gene Names: RPA3Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens...

Recombinant Human Replication protein A 32KDA subunit (RPA2), partial | CSB-EP020089HU1 | CusabioAlternative Name(s): Replication factor A protein 2 ;RF-A protein 2Replication protein A 34KDA subunit ;RP-A p34Gene Names: RPA2Research Areas: Epigenetics...

Recombinant Human Replication protein A 70kDa DNA-binding subunit (RPA1) | CSB-EP020088HU | CusabioAlternative Name(s): Replication factor A protein 1 ;RF-A protein 1Single-stranded DNA-binding proteinGene Names: RPA1Research Areas: Epigenetics and...

Recombinant Human Protein XRP2 (RP2) | CSB-EP020076HU | CusabioAlternative Name(s): RP2; Protein XRP2Gene Names: RP2Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Nuclear receptor ROR-gamma (RORC) | CSB-EP020071HU | CusabioAlternative Name(s): Nuclear receptor RZR-gammaNuclear receptor subfamily 1 group F member 3RAR-related orphan receptor CRetinoid-related orphan receptor-gammaGene Names:...

Recombinant Human Nuclear receptor ROR-alpha (RORA) | CSB-EP020069HUa0 | CusabioAlternative Name(s): Nuclear receptor RZR-alpha (Nuclear receptor subfamily 1 group F member 1) (RAR-related orphan receptor A) (Retinoid-related orphan receptor-alpha)...

Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial | CSB-EP020067HU | CusabioAlternative Name(s): Neurotrophic tyrosine kinase, receptor-related 1Gene Names: ROR1Research Areas: NeuroscienceOrganism: Homo...

Recombinant Human Ropporin-1B (ROPN1B), partial | CSB-EP020065HU | CusabioAlternative Name(s): Rhophilin-associated protein 1BGene Names: ROPN1BResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ribonuclease inhibitor (RNH1) | CSB-EP019901HUb1 | CusabioAlternative Name(s): Placental ribonuclease inhibitor;Placental RNase inhibitor;Ribonuclease/angiogenin inhibitor 1;RAIGene Names: RNH1Research Areas: CardiovascularOrganism:...

Recombinant Human Ribonuclease inhibitor (RNH1) | CSB-EP019901HU | CusabioAlternative Name(s): Ribonuclease inhibitor(Placental ribonuclease inhibitor)(Placental RNase inhibitor)(Ribonuclease/angiogenin inhibitor 1)(RAI)Gene Names: RNH1Research Areas:...

Recombinant Human E3 ubiquitin-protein ligase RNF8 (RNF8) | CSB-EP019898HU | CusabioAlternative Name(s): RING finger protein 8 ?RING-type E3 ubiquitin transferase RNF8?Gene Names: RNF8Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human RING-box protein 2 (RNF7) | CSB-EP019897HU | CusabioAlternative Name(s): CKII beta-binding protein 1 ;CKBBP1RING finger protein 7Regulator of cullins 2Sensitive to apoptosis gene proteinGene Names: RNF7Research Areas: Epigenetics and...

Recombinant Human ORC ubiquitin ligase 1 (OBI1), partial | CSB-EP019878HU1 | CusabioAlternative Name(s): RING finger protein 219Gene Names: OBI1Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human RING finger protein 212 (RNF212) | CSB-EP019872HU | CusabioAlternative Name(s): RING finger protein 212Gene Names: RNF212Research Areas: Epigenetics and Nuclear Signaling Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Human RING finger protein 114 (RNF114) | CSB-EP019821HU | CusabioAlternative Name(s): RING finger protein 114 Zinc finger protein 228 Zinc finger protein 313Gene Names: RNF114Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo...

Recombinant Human Ribonuclease H1 (RNASEH1) | CSB-EP019801HU | CusabioAlternative Name(s): Ribonuclease H type II RNH1Gene Names: RNASEH1Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ribonuclease 4 (RNASE4) | CSB-EP019796HU | CusabioAlternative Name(s): RNS4Gene Names: RNASE4Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Non-secretory ribonuclease (RNASE2) | CSB-EP019794HU | CusabioAlternative Name(s): Eosinophil-derived neurotoxinRNase UpI-2Ribonuclease 2 ;RNase 2Ribonuclease USGene Names: RNASE2Research Areas: ImmunologyOrganism: Homo sapiens...

Recombinant Human Receptor-interacting serine/threonine-protein kinase 2 (RIPK2) | CSB-EP019736HU | CusabioAlternative Name(s): CARD-containing interleukin-1 beta-converting enzyme-associated kinase ;CARD-containing IL-1 beta...

Recombinant Human Rho-related GTP-binding protein RhoG (RHOG) | CSB-EP019690HU | CusabioAlternative Name(s): Rho-related GTP-binding protein RhoGGene Names: RHOGResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Rho-related GTP-binding protein RhoD (RHOD) | CSB-EP019688HU | CusabioAlternative Name(s): Rho-related protein HP1Gene Names: RHODResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Rhodopsin (RHO), partial | CSB-EP019681HU | CusabioAlternative Name(s): Opsin-2Gene Names: RHOResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence: MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQSource: E.coliTag Info:...

Recombinant Human Blood group Rh (D) polypeptide (RHD), partial | CSB-EP019677HU | CusabioAlternative Name(s): RHXIII Rh polypeptide 2 Short name: RhPII Rhesus D antigen CD_antigen: CD240DGene Names: RHDResearch Areas: CardiovascularOrganism: Homo...

Recombinant Human Rhomboid-related protein 2 (RHBDL2), partial | CSB-EP019672HU | CusabioAlternative Name(s): Rhomboid-like protein 2Gene Names: RHBDL2Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Regulator of G-protein signaling 7 (RGS7) | CSB-EP019659HU | CusabioAlternative Name(s): RGS7; Regulator of G-protein signaling 7; RGS7Gene Names: RGS7Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Regulator of G-protein signaling 5 (RGS5) | CSB-EP019657HU | CusabioAlternative Name(s): MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129; Regulator of G Protein Signalling 5; Regulator of G-protein signaling 5; RGS 5; RGS5;...

Recombinant Human Regulator of G-protein signaling 20 (RGS20) | CSB-EP019652HU | CusabioAlternative Name(s): Gz-selective GTPase-activating proteinGene Names: RGS20Research Areas: Signal Transduction Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Regulator of G-protein signaling 2 (RGS2) | CSB-EP019651HU | CusabioAlternative Name(s): Cell growth-inhibiting gene 31 protein;G0/G1 switch regulatory protein 8Gene Names: RGS2Research Areas: Signal TransductionOrganism: Homo sapiens...

Recombinant Human Regulator of G-protein signaling 10 (RGS10) | CSB-EP019642HU | CusabioAlternative Name(s): Regulator of G protein signaling 10; Regulator of G-protein signaling 10; RGS10; RGS10_HUMANGene Names: RGS10Research Areas: Signal...

Recombinant Human Replication factor C subunit 1 (RFC1), partial | CSB-EP019588HU | CusabioAlternative Name(s): Activator 1 140KDA subunitGene Names: RFC1Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Resistin (RETN) | CSB-EP019573HU | CusabioAlternative Name(s): Adipose tissue-specific secretory factor ;ADSFC/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein;Cysteine-rich secreted protein A12-alpha-like...

Recombinant Human Reelin (RELN), partial | CSB-EP019557HU | CusabioAlternative Name(s): LIS2; PRO1598; Reeler; Reelin; RELN; RELN_HUMAN; RLGene Names: RELNResearch Areas: Cell AdhesionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Proto-oncogene c-Rel (REL), partial | CSB-EP019552HU | CusabioAlternative Name(s): Avian reticuloendotheliosis ; C REL; C Rel protein; c Rel proto oncogene protein; Oncogene REL ; Oncogene REL avian reticuloendotheliosis; Proto-oncogene...

Recombinant Human Regenerating islet-derived protein 3-alpha (REG3A) | CSB-EP019548HU | CusabioAlternative Name(s): Hepatointestinal pancreatic protein ;HIP/PAPHuman proislet peptidePancreatitis-associated protein 1Regenerating islet-derived protein...

Recombinant Human ATP-dependent DNA helicase Q1 (RECQL) | CSB-EP019537HU | CusabioAlternative Name(s): DNA helicase, RecQ-like type 1 Short name: RecQ1 DNA-dependent ATPase Q1 RecQ protein-like 1 RECQ1, RECQL1Gene Names: RECQLResearch Areas: Epigenetics...

Recombinant human Retinol dehydrogenase 11 (RDH11), partial | CSB-EP019523HU | CusabioAlternative Name(s): Androgen-regulated short-chain dehydrogenase/reductase 1HCV core-binding protein HCBP12;Prostate short-chain dehydrogenase/reductase 1Retinal...

Recombinant Human Recoverin (RCVRN) | CSB-EP019519HU | CusabioAlternative Name(s): Cancer-associated retinopathy protein ;Protein CARGene Names: RCVRNResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human E3 ubiquitin-protein ligase RBX1 (RBX1) | CSB-EP019496HU | CusabioAlternative Name(s): Protein ZYP RING finger protein 75 RING-box protein 1Gene Names: RBX1Research Areas: Cell Biology Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Retinol-binding protein 2 (RBP2) | CSB-EP019481HU | CusabioAlternative Name(s): Cellular retinol-binding protein IIGene Names: RBP2Research Areas: Signal Transduction Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial | CSB-EP019444HU1 | CusabioAlternative Name(s): Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G) (hnRNP G) (HNRPG) (RBMXP1)Gene Names: RBMXResearch Areas: Epigenetics...

Recombinant Human RNA binding protein fox-1 homolog 2 (RBFOX2) | CSB-EP019439HU | CusabioAlternative Name(s): Fox-1 homolog BHexaribonucleotide-binding protein 2RNA-binding motif protein 9RNA-binding protein 9Repressor of tamoxifen transcriptional...

Recombinant Human Putative RNA-binding protein 3 (RBM3) | CSB-EP019420HU | CusabioAlternative Name(s): RNA-binding motif protein 3RNPLGene Names: RBM3Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ribokinase (RBKS), partial | CSB-EP019397HU | CusabioAlternative Name(s): RBKS; RBSK; Ribokinase; RK; EC 2.7.1.15Gene Names: RBKSResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ras GTPase-activating protein 1 (RASA1), partial | CSB-EP019346HU | CusabioAlternative Name(s): Ras p21 protein activator (p120GAP)Gene Names: RASA1Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ras-related protein Rap-2b (RAP2B) | CSB-EP019327HU | CusabioAlternative Name(s): MGC20484; RAP 2B; RAP2A; Rap2b; RAP2B member of RAS oncogene family; RAP2B_HUMAN; Ras family small GTP binding protein RAP2B; Ras related protein RAP 2B;...

Recombinant Human E3 SUMO-protein ligase RanBP2 (RANBP2), partial | CSB-EP019311HU | CusabioAlternative Name(s): 358KDA nucleoporin Nuclear pore complex protein Nup358 Nucleoporin Nup358 Ran-binding protein 2Gene Names: RANBP2Research Areas:...

Recombinant Human GTP-binding nuclear protein Ran (RAN) | CSB-EP019307HU | CusabioAlternative Name(s): Androgen receptor-associated protein 24 GTPase Ran Ras-like protein TC4 Ras-related nuclear proteinGene Names: RANResearch Areas: Cell Biology...

Recombinant Human Ras-related protein Ral-B (RALB) | CSB-EP019297HU | CusabioAlternative Name(s): 5730472O18Rik; dRalb; GTP binding protein; Ralb; RALB_HUMAN; RAS like protein B; RAS like proto oncogene B; Ras related GTP binding protein B; Ras-related...

Recombinant Human RAF proto-oncogene serine/threonine-protein kinase (RAF1) | CSB-EP019284HU | CusabioAlternative Name(s): Proto-oncogene c-RAF ;cRafRaf-1Gene Names: RAF1Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human mRNA export factor (RAE1) | CSB-EP019276HU | CusabioAlternative Name(s): Rae1 protein homolog mRNA-associated protein mrnp 41Gene Names: RAE1Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human DNA repair protein RAD51 homolog 4 (RAD51D) | CSB-EP019268HU | CusabioAlternative Name(s): R51H3 RAD51 homolog D RAD51-like protein 3 TRADGene Names: RAD51L3Research Areas: Epigenetics and Nuclear Signaling Organism: Homo sapiens...

Recombinant Human UV excision repair protein RAD23 homolog A (RAD23A) (T131A) | CSB-EP019259HU(M) | CusabioAlternative Name(s): UV excision repair protein RAD23 homolog A(HR23A)(hHR23A)Gene Names: RAD23AResearch Areas: Epigenetics and Nuclear...

Recombinant Human UV excision repair protein RAD23 homolog A (RAD23A) | CSB-EP019259HU | CusabioAlternative Name(s): hHR 23A; hHR23A; HR23A; MGC111083; RAD 23a; RAD23 homolog A (S. cerevisiae); RAD23 homolog A; RAD23 yeast homolog A; RAD23A; RD23A_HUMAN;...

Recombinant Human Cell cycle checkpoint protein RAD1 (RAD1) | CSB-EP019252HU | CusabioAlternative Name(s): DNA repair exonuclease rad1 homolog Rad1-like DNA damage checkpoint proteinGene Names: RAD1Research Areas: Epigenetics and Nuclear Signaling...

Recombinant Human Ras-related C3 botulinum toxin substrate 3 (RAC3) | CSB-EP019249HU | CusabioAlternative Name(s): p21-Rac3Gene Names: RAC3Research Areas: Signal Transduction Organism: Homo sapiens (Human)AA Sequence:...