Cusabio Human Recombinants
Recombinant Human Protein S100-A1 (S100A1) | CSB-EP020622HU
- SKU:
- CSB-EP020622HU
- UPC:
- MPN:
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Protein S100-A1 (S100A1) | CSB-EP020622HU | Cusabio
Alternative Name(s): S-100 protein alpha chain;S-100 protein subunit alpha;S100 calcium-binding protein A1
Gene Names: S100A1
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 2-94aa
Sequence Info: Full Length of Mature Protein
MW: 26.4 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity.
Reference: S100 alpha, CAPL, and CACY molecular cloning and expression analysis of three calcium-binding proteins from human heart.Engelkamp D., Schaefer B.W., Erne P., Heizmann C.W.Biochemistry 31:10258-10264(1992)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Probably acts as a Ca(2+) signal transducer
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: S-100 family
Tissue Specificity: Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P23297
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM
Related Products

Recombinant Human Protein S100-A10 (S100A10) | CSB-EP020623HU
Cusabio Human Recombinants

Recombinant Human Protein S100-A7A (S100A7A), partial | CSB-YP771423HU
Cusabio Human Recombinants

Recombinant Human Protein S100-A14 (S100A14) | CSB-YP875728HU
Cusabio Human Recombinants

Recombinant Human Protein S100-A14 (S100A14) | CSB-YP875728HUa4
Cusabio Human Recombinants

Rat Protein S100-A1 (S100A1) ELISA kit | CSB-EL020622RA
Cusabio Elisa
Customers Also Viewed

Human Protein S100-A7A (S100A7A) ELISA kit | CSB-EL020636HU
Cusabio Elisa

Recombinant Human Protein S100-A14 (S100A14) | CSB-YP875728HU
Cusabio Human Recombinants

Fuca1 Antibody | CSB-PA858759LA01MO
Cusabio Polyclonal Antibodies

FUCA1 Antibody, FITC conjugated | CSB-PA009062LC01HU
Cusabio Polyclonal Antibodies

FUCA1 Antibody, HRP conjugated | CSB-PA009062LB01HU
Cusabio Polyclonal Antibodies

CXCL8 Antibody, Biotin conjugated | CSB-PA08329D0Rb
Cusabio Polyclonal Antibodies

CD44 Antibody | CSB-PA685145
Cusabio Polyclonal Antibodies

Human anti-Helicobacter pylori (Hp) antibody (IgG) ELISA kit | CSB-E09402h
Cusabio Elisa

Human Helicobacter pylori antibody (IgA) ELISA Kit | CSB-E17034h
Cusabio Elisa

Human anti-Endomysial antibody (EMA) (IgA) ELISA kit | CSB-E08828h
Cusabio Elisa

Human Acetylcholinesterase (AChE) antibody (IgG) ELISA Kit | CSB-E13358h
Cusabio Elisa

Mouse Thyroid-Peroxidase, TPO ELISA Kit | CSB-E08353m
Cusabio Elisa

Mouse Sonic hedgehog protein (SHH) ELISA kit | CSB-EL021266MO
Cusabio Elisa

Mouse Galectin-9 (LGALS9) ELISA kit | CSB-EL012895MO
Cusabio Elisa

Mouse Galectin 3 (GAL-3) ELISA Kit | CSB-E14296m
Cusabio Elisa

Mouse Lipopolysaccharide-binding protein (LBP) ELISA kit | CSB-EL012775MO
Cusabio Elisa

Human glypican 1 (GPC1) ELISA kit | CSB-EL009703HU
Cusabio Elisa

Human activated coagulation factor X (FXa) ELISA kit | CSB-E12696h
Cusabio Elisa

Human coagulation factor Ⅹ, FⅩ ELISA Kit | CSB-E08440h
Cusabio Elisa

Mouse Neuron-specific enolase, NSE ELISA Kit | CSB-E07962m
Cusabio Elisa

Mouse Bone morphogenetic protein 2, BMP-2 ELISA Kit | CSB-E04509m
Cusabio Elisa

Human Apolipoprotein C2, apo-C2 ELISA Kit | CSB-E14174h
Cusabio Elisa

Human interferon alpha-2 (IFNA2) ELISA kit | CSB-EL011038HU
Cusabio Elisa

Rat Thyroid-Peroxidase, TPO ELISA Kit | CSB-E08352r
Cusabio Elisa

Rat ovalbumin specific IgE, OVA sIgE ELISA Kit | CSB-E08913r
Cusabio Elisa

Pig Neuron-specific enolase, NSE ELISA Kit | CSB-E14065p
Cusabio Elisa

Human lipolysaccharide binding protein, LBP ELISA Kit | CSB-E09629h
Cusabio Elisa

Rat Acetylcholinesterase, AChE ELISA Kit | CSB-E11304r
Cusabio Elisa

Human Neuron-specific enolase, NSE ELISA Kit | CSB-E07961h
Cusabio Elisa

Prev 200605 09
JopLink

Prev 200103 3
JopLink

Ischemic Pancreatitis
JopLink

Reductive Stress
JopLink

Retroperitoneal Schwannoma
JopLink

Sbrt For Pancreatic Cancer
JopLink

Schwannoma S100
JopLink

Von Hippel Lindau Radiology
JopLink

Recombinant Human Protein S100-A14 (S100A14) | CSB-YP875728HUa4
Cusabio Human Recombinants

Recombinant Human Protein S100-A7A (S100A7A), partial | CSB-YP771423HU
Cusabio Human Recombinants

Recombinant Human Protein S100-A14 (S100A14) | CSB-EP875728HU
Cusabio Human Recombinants

Recombinant Mouse Protein S100-A9 (S100a9) | CSB-EP020642MO
Cusabio Mouse Recombinants

Recombinant Human Protein S100-A10 (S100A10) | CSB-EP020623HU
Cusabio Human Recombinants

GAPDH Monoclonal Antibody | CSB-MA000071M2m
Cusabio Tag & Control

GAPDH Monoclonal Antibody | CSB-MA000071M1m
Cusabio Tag & Control

GAPDH Monoclonal Antibody | CSB-MA000071M0m
Cusabio Tag & Control

Flag Tag Monoclonal Antibody | CSB-MA000021M0m
Cusabio Tag & Control

HA-Tag Monoclonal Antibody | CSB-MA000141M0m
Cusabio Tag & Control

Sumo tag Monoclonal Antibody | CSB-MA000131M0m
Cusabio Tag & Control

APP Antibody | CSB-RA994273A0HU
Cusabio Recombinant Antibodies

IRAK4 Antibody | CSB-RA284992A0HU
Cusabio Recombinant Antibodies