E.coli Recombinant

Recombinant Mouse RNA binding protein fox-1 homolog 3 (Rbfox3) | CSB-EP806847MO | CusabioAlternative Name(s): Fox-1 homolog C (Hexaribonucleotide-binding protein 3) (Fox-3) (Neuronal nuclei antigen) (NeuN antigen) (D11Bwg0517e) (Hrnbp3)Gene Names:...

Recombinant Vesicular stomatitis Indiana virus Matrix protein (M) | CSB-EP806800VBF | CusabioAlternative Name(s): M; Matrix proteinGene Names: MResearch Areas: Signal TransductionOrganism: Vesicular stomatitis Indiana virus (strain 98COE North America)...

Recombinant Mouse Kallikrein-14 (Klk14) | CSB-EP806542MOa2 | CusabioAlternative Name(s): Glandular kallikrein KLK14Gene Names: Klk14Research Areas: Tags & Cell MarkersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Kallikrein-14 (Klk14) | CSB-EP806542MO | CusabioAlternative Name(s): Glandular kallikrein KLK14Gene Names: Klk14Research Areas: Tags & Cell MarkersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Serine protease inhibitor Kazal-type 2 (Spink2) | CSB-EP806409MO | CusabioAlternative Name(s): Spink2; Serine protease inhibitor Kazal-type 2Gene Names: Spink2Research Areas: Cell BiologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Vesicular stomatitis Indiana virus RNA-directed RNA polymerase L (L), partial | CSB-EP806333VBE | CusabioAlternative Name(s): Large structural protein Replicase TranscriptaseGene Names: LResearch Areas: OthersOrganism: Vesicular stomatitis...

Recombinant Mouse Sushi domain-containing protein 4 (Susd4), partial | CSB-EP805887MOa0 | CusabioAlternative Name(s): Susd4; Sushi domain-containing protein 4Gene Names: Susd4Research Areas: Cell BiologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Sushi domain-containing protein 4 (Susd4), partial | CSB-EP805887MO | CusabioAlternative Name(s): Susd4; Sushi domain-containing protein 4Gene Names: Susd4Research Areas: Cell BiologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse WD repeat-containing and planar cell polarity effector protein fritz homolog (Wdpcp) | CSB-EP804911MO | CusabioAlternative Name(s): Homolog-13WD repeat-containing and planar cell polarity effector proteinGene Names: WdpcpResearch Areas:...

Recombinant Mouse Trifunctional enzyme subunit alpha, mitochondrial (Hadha), partial | CSB-EP804834MO | CusabioAlternative Name(s): TP-alphaGene Names: HadhaResearch Areas: CancerOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Carbamoyl-phosphate synthase [ammonia], mitochondrial (Cps1), partial | CSB-EP804448MO | CusabioAlternative Name(s): Carbamoyl-phosphate synthase [ammonia], mitochondrial(EC 6.3.4.16)(Carbamoyl-phosphate synthetase I)(CPSase I)Gene...

Recombinant Mouse Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial (Dlat) | CSB-EP804374MOa0 | CusabioAlternative Name(s): Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase...

Recombinant Mouse Enoyl-CoA hydratase,  mitochondrial (Echs1) (C225S) | CSB-EP804339MO(M) | CusabioAlternative Name(s): Enoyl-CoA hydratase 1 Short-chain enoyl-CoA hydrataseGene Names: Echs1Research Areas: metabolismOrganism: Mus musculus (Mouse)AA...

Recombinant Mouse Enoyl-CoA hydratase, mitochondrial (Echs1) | CSB-EP804339MO | CusabioAlternative Name(s): Enoyl-CoA hydratase 1 (Short-chain enoyl-CoA hydratase) (SCEH)Gene Names: Echs1Research Areas: CancerOrganism: Mus musculus(Mouse)AA Sequence:...

Recombinant Human metapneumovirus Phosphoprotein (P) | CSB-EP804307HDAM | CusabioAlternative Name(s): Protein PGene Names: PResearch Areas: Signal TransductionOrganism: Human metapneumovirus(strain CAN97-83)(HMPV)AA Sequence:...

Recombinant Mouse Sialidase-4 (Neu4) | CSB-EP803970MO | CusabioAlternative Name(s): N-acetyl-alpha-neuraminidase 4 (Neuraminidase 4)Gene Names: Neu4Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse C-type lectin domain family 4 member G (Clec4g), partial | CSB-EP803912MO | CusabioAlternative Name(s): /Gene Names: Clec4gResearch Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Thioredoxin-interacting protein (Txnip) | CSB-EP803849MO | CusabioAlternative Name(s): Vitamin D3 up-regulated protein 1Gene Names: TxnipResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Pseudomonas syringae pv. tomato Effector protein hopM1 (hopM1) | CSB-EP803414FGP(A4) | CusabioAlternative Name(s): Hrp outer protein M1 (Type III effector HopPtoM) (holPtoX) (hopPtoM)Gene Names: hopM1Research Areas: OthersOrganism:...

Recombinant Human Interferon epsilon (IFNE) | CSB-EP803137HU | CusabioAlternative Name(s): Interferon epsilon-1Gene Names: IFNEResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Chromodomain-helicase-DNA-binding protein 1-like (CHD1L), partial | CSB-EP803136HU | CusabioAlternative Name(s): Amplified in liver cancer protein 1Gene Names: CHD1LResearch Areas: Epigenetics and Nuclear Signaling Organism: Homo...

Recombinant Klebsiella oxytoca Carbepenem-hydrolyzing beta-lactamase KPC (bla) | CSB-EP802889KBE | CusabioAlternative Name(s): Carbapenem-hydrolyzing beta-lactamase KPC-2Gene Names: blaResearch Areas: OthersOrganism: Klebsiella oxytocaAA Sequence:...

Recombinant Human V-set domain-containing T-cell activation inhibitor 1 (B7H4), partial | CSB-EP801822HUe0 | CusabioAlternative Name(s): B7 homolog 4 ;B7-H4B7h.5Immune costimulatory protein B7-H4Protein B7S1T-cell costimulatory molecule B7xGene Names:...

Recombinant Human V-set domain-containing T-cell activation inhibitor 1 (B7H4), partial | CSB-EP801822HU | CusabioAlternative Name(s): B7 homolog 4 ;B7-H4B7h.5Immune costimulatory protein B7-H4Protein B7S1T-cell costimulatory molecule B7xGene Names:...

Recombinant Human Transforming growth factor beta activator LRRC33 (NRROS), partial | CSB-EP801264HU | CusabioAlternative Name(s): Leucine-rich repeat-containing protein 33 LRRC33Gene Names: NRROSResearch Areas: OthersOrganism: Homo sapiens (Human)AA...

Recombinant Human Lipolysis-stimulated lipoprotein receptor (LSR), partial | CSB-EP801252HU | CusabioAlternative Name(s): ILDR3; Immunoglobulin like domain containing receptor 3; Lipolysis Stimulated Lipoprotein Receptor; Lipolysis stimulated remnant;...

Recombinant Human Vacuolar fusion protein MON1 homolog A (MON1A), partial | CSB-EP801242HU | CusabioAlternative Name(s): FLJ97088; MGC13272; MON1 homolog A; MON1A; MON1A_HUMAN; SAND1; Vacuolar fusion protein MON1 homolog AGene Names: MON1AResearch Areas:...

Recombinant Human Protein PAT1 homolog 1 (PATL1) | CSB-EP801224HU | CusabioAlternative Name(s): PAT1-like protein 1;Protein PAT1 homolog b;Pat1b;hPat1bGene Names: PATL1Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA...

Recombinant Mouse Interferon epsilon (Ifne) | CSB-EP800374MO | CusabioAlternative Name(s): Interferon epsilon-1Interferon tau-1Gene Names: IfneResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Septin-9 (Septin9) | CSB-EP800330MO | CusabioAlternative Name(s): SL3-3 integration site 1 protein Kiaa0991, Sint1Gene Names: Septin9Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Filamin-A-interacting protein 1 (FILIP1), partial | CSB-EP800226HU | CusabioAlternative Name(s): Filamin-A-interacting protein 1; FILIP; FILIP1; FLIP1_HUMANGene Names: FILIP1Research Areas: OthersOrganism: Homo sapiens (Human)AA...

Recombinant Arabidopsis thaliana GRF1-interacting factor 1 (GIF1) | CSB-EP781430DOA | CusabioAlternative Name(s): GRF1-interacting factor 1(AtGIF1)(Protein ANGUSTIFOLIA 3)(Transcription coactivator GIF1)Gene Names: GIF1Research Areas: Signal...

Recombinant Human B melanoma antigen 2 (BAGE2) | CSB-EP774832HU | CusabioAlternative Name(s): Cancer/testis antigen 2.2Gene Names: BAGE2Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human TIR domain-containing adapter molecule 2 (TICAM2) | CSB-EP774830HU | CusabioAlternative Name(s): Putative NF-kappa-B-activating protein 502 TRIF-related adapter molecule Toll-like receptor adaptor protein 3 Toll/interleukin-1 receptor...

Recombinant Human Tripartite motif-containing protein 69 (TRIM69) | CSB-EP774824HU | CusabioAlternative Name(s): RFP-like domain-containing protein trimless RING finger protein 36 Tripartite motif-containing protein 69Gene Names: TRIM69Research Areas:...

Recombinant Human Vasculin (GPBP1), partial | CSB-EP774823HU | CusabioAlternative Name(s): GC-rich promoter-binding protein 1Vascular wall-linked proteinGene Names: GPBP1Research Areas: TranscriptionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Valacyclovir hydrolase (BPHL) | CSB-EP774821HU(F1) | CusabioAlternative Name(s): Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp)(Breast epithelial mucin-associated antigen) (MCNAA)Gene Names: BPHLResearch...

Recombinant Human Valacyclovir hydrolase (BPHL) | CSB-EP774821HU | CusabioAlternative Name(s): Biphenyl hydrolase-like protein;Biphenyl hydrolase-related protein ;Bph-rpBreast epithelial mucin-associated antigen ;MCNAAGene Names: BPHLResearch Areas:...

Recombinant Artemisia vulgaris Major pollen allergen Art v 1 | CSB-EP774628AOH | CusabioAlternative Name(s): Defensin-like protein 1 Allergen: Art v 1Gene Names: N/AResearch Areas: OthersOrganism: Artemisia vulgaris (Mugwort)AA Sequence:...

Recombinant Androctonus mauretanicus mauretanicus Alpha-toxin Amm8 | CSB-EP773772AKB | CusabioAlternative Name(s): Alpha-anatoxin Amm VIII (Amm VIII) (AmmVIII) (Neurotoxin 8) (P4)Gene Names: N/AResearch Areas: OthersOrganism: Androctonus mauritanicus...

Recombinant Human Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) | CSB-EP773600HU | CusabioAlternative Name(s): EVH1 domain-containing protein 1; EVH1/Sprouty domain containing protein; FLJ33903; hSpred 1; hSpred1; NFLS; PPP1R147; protein...

Recombinant Human Probable ATP-dependent RNA helicase DDX53 (DDX53) | CSB-EP773024HU | CusabioAlternative Name(s): Cancer-associated gene protein Cancer/testis antigen 26 Short name: CT26 DEAD box protein 53 DEAD box protein CAGE CAGEGene Names:...

Recombinant Human papillomavirus type 6a protein E4 (E4) | CSB-EP772797HOM | CusabioAlternative Name(s): /Gene Names: E4Research Areas: OthersOrganism: Human papillomavirus type 6aAA Sequence:...

Recombinant Human Beta-defensin 128 (DEFB128) | CSB-EP772034HU | CusabioAlternative Name(s): Beta-defensin 28 Defensin, beta 128Gene Names: DEFB128Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human L-xylulose reductase (DCXR) | CSB-EP772022HU | CusabioAlternative Name(s): Carbonyl reductase II Dicarbonyl/L-xylulose reductase Kidney dicarbonyl reductaseGene Names: DCXRResearch Areas: Signal Transduction Organism: Homo sapiens...

Recombinant Human Prolyl 4-hydroxylase subunit alpha-3 (P4HA3) | CSB-EP772021HU | CusabioAlternative Name(s): Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-3Gene Names: P4HA3Research Areas: Signal TransductionOrganism: Homo sapiens...

Recombinant Human Protein prune homolog (PRUNE) | CSB-EP771430HU | CusabioAlternative Name(s): Drosophila-related expressed sequence 17 ;DRES-17 ;DRES17HTcD37Gene Names: PRUNEResearch Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Protein S100-A7A (S100A7A), partial | CSB-EP771423HU | CusabioAlternative Name(s): S100A7A; S100A15; S100A7L1; Protein S100-A7A; S100 calcium-binding protein A15; S100 calcium-binding protein A7-like 1; S100 calcium-binding protein...

Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), Partial | CSB-EP771258PI | CusabioAlternative Name(s): CD_antigen: CD124Gene Names: IL4RResearch Areas: CancerOrganism: Sus scrofa (Pig)AA Sequence:...

Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial | CSB-EP771253EQVa2 | CusabioAlternative Name(s): Tumor necrosis factor C ;TNF-CTumor necrosis factor ligand superfamily member 3Gene Names: LTBResearch Areas: OthersOrganism: Pan troglodytes...

Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial | CSB-EP771253EQV | CusabioAlternative Name(s): Tumor necrosis factor C ;TNF-CTumor necrosis factor ligand superfamily member 3Gene Names: LTBResearch Areas: OthersOrganism: Pan troglodytes...

Recombinant Bacillus anthracis Single-stranded DNA-binding protein (ssb) | CSB-EP770616BQE | CusabioAlternative Name(s): ssb; ssb-1; BA_5722; GBAA_5722; BAS5326Single-stranded DNA-binding protein; SSBGene Names: ssbResearch Areas: OthersOrganism:...

Recombinant Mouse Normal mucosa of esophagus-specific gene 1 protein (Nmes1) | CSB-EP770515MO | CusabioAlternative Name(s): Nmes1Normal mucosa of esophagus-specific gene 1 proteinGene Names: Nmes1Research Areas: OthersOrganism: Mus musculus (Mouse)AA...

Recombinant Mouse Carnosine N-methyltransferase (Carnmt1), partial | CSB-EP770467MO1a2 | CusabioAlternative Name(s): Gene Names: Carnmt1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Src kinase-associated phosphoprotein 1 (SKAP1) | CSB-EP769799HU | CusabioAlternative Name(s): Src family-associated phosphoprotein 1Src kinase-associated phosphoprotein of 55KDA ;SKAP-55 ;pp55Gene Names: SKAP1Research Areas:...

Recombinant Human Vasohibin-2 (VASH2) | CSB-EP769783HU | CusabioAlternative Name(s): Vasohibin-like proteinGene Names: VASH2Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Shigella flexneri Adenylate kinase (adk) | CSB-EP769467SZB | CusabioAlternative Name(s): ATP-AMP transphosphorylase ATP:AMP phosphotransferase Adenylate monophosphate kinaseGene Names: adkResearch Areas: Signal TransductionOrganism: Shigella...

Recombinant Enterococcus faecalis Gelatinase (gelE) | CSB-EP769310ELW | CusabioAlternative Name(s): CoccolysinGene Names: gelEResearch Areas: OthersOrganism: Enterococcus faecalis (strain ATCC 700802 / V583)AA Sequence:...

Recombinant Mouse Serine/threonine-protein kinase VRK1 (Vrk1) | CSB-EP768902MO | CusabioAlternative Name(s): Serine/threonine-protein kinase 51PK Vaccinia-related kinase 1Gene Names: Vrk1Research Areas: Cell BiologyOrganism: Mus musculus (Mouse)AA...

Recombinant Human Neuroepithelial cell-transforming gene 1 protein (NET1) | CSB-EP768775HU | CusabioAlternative Name(s): Proto-oncogene p65 Net1Rho guanine nucleotide exchange factor 8Gene Names: NET1Research Areas: Signal TransductionOrganism: Homo...

Recombinant Human 1-phosphatidylinositol 4, 5-bisphosphate phosphodiesterase zeta-1 (PLCZ1) | CSB-EP768240HU | CusabioAlternative Name(s): Phosphoinositide phospholipase C-zeta-1;Phospholipase C-zeta-11Gene Names: PLCZ1Research Areas: CancerOrganism:...

Recombinant Human Ly6/PLAUR domain-containing protein 6 (LYPD6) | CSB-EP768237HU | CusabioAlternative Name(s): LYPD6; UNQ3023/PRO9821Ly6/PLAUR domain-containing protein 6Gene Names: LYPD6Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA...

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), Partial | CSB-EP768213HU | CusabioAlternative Name(s): ITIH5; KIAA1953; PP14776; UNQ311/PRO354; Inter-alpha-trypsin inhibitor heavy chain H5; ITI heavy chain H5; ITI-HC5;...

Recombinant Vesicular stomatitis Indiana virus Protein C' (P) | CSB-EP768100VBH | CusabioAlternative Name(s): PProtein C'Gene Names: pResearch Areas: OthersOrganism: Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV)AA Sequence:...

Recombinant Mouse Glycoprotein hormone beta-5 (Gphb5) | CSB-EP767382MO | CusabioAlternative Name(s): Thyrostimulin subunit betaGene Names: Gphb5Research Areas: Signal TransductionOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Keratin, type II cytoskeletal 1b (KRT77) | CSB-EP767211HU | CusabioAlternative Name(s): Cytokeratin-1B ;CK-1BKeratin-77 ;K77Type-II keratin Kb39Gene Names: KRT77Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA...

Recombinant Portulaca grandiflora 4, 5-DOPA dioxygenase extradiol (DODA) | CSB-EP767105PIAD | CusabioAlternative Name(s): DODA4,5-DOPA dioxygenase extradiol; EC 1.13.11.29Gene Names: DODAResearch Areas: OthersOrganism: Portulaca grandiflora (Rose moss)AA...

Recombinant Salmo salar Elastase-1 | CSB-EP766453SWI | CusabioAlternative Name(s): Gene Names: N/AResearch Areas: OthersOrganism: Salmo salar (Atlantic salmon)AA Sequence:...

Recombinant Mycobacterium tuberculosis Methionine aminopeptidase 1 (map-1) | CSB-EP765906MVZ | CusabioAlternative Name(s): Peptidase M (MAP 1) (MetAP 1) (mapA)Gene Names: map-1Research Areas: Signal TransductionOrganism: Mycobacterium tuberculosis...

Recombinant Mouse Thymosin beta-10 (Tmsb10) | CSB-EP765096MO | CusabioAlternative Name(s): Tmsb10;Ptmb10Gene Names: Tmsb10Research Areas: Signal TransductionOrganism: Mus musculus (Mouse)AA Sequence: ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEISSource: E...

Recombinant Zaire ebolavirus Polymerase cofactor VP35 (VP35) | CSB-EP764950ZAT | CusabioAlternative Name(s): Ebola VP35; eVP35Gene Names: VP35Research Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)AA Sequence:...

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial | CSB-EP764949ZAT | CusabioAlternative Name(s): Large structural proteinGene Names: LResearch Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV)AA Sequence:...

Recombinant Human Insulin growth factor-like family member 1 (IGFL1) | CSB-EP764932HU | CusabioAlternative Name(s): IGFL1; UNQ644/PRO1274; Insulin growth factor-like family member 1Gene Names: IGFL1Research Areas: OthersOrganism: Homo sapiens (Human)AA...

Recombinant Mouse Toll-like receptor 11 (Tlr11), partial | CSB-EP764846MO | CusabioAlternative Name(s): Toll-like receptor 12Gene Names: Tlr11Research Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Twinfilin-2 (TWF2) | CSB-EP764224HU | CusabioAlternative Name(s): A6-related proteinGene Names: TWF2Research Areas: Signal Transduction Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Staphylococcus aureus ESAT-6 secretion system extracellular protein A (esxA) | CSB-EP763968SKW | CusabioAlternative Name(s): esxA; SAS0258Type VII secretion system extracellular protein A; Ess extracellular protein AGene Names: esxAResearch...

Recombinant Staphylococcus aureus Iron-regulated surface determinant protein A (isdA) | CSB-EP763937SKW | CusabioAlternative Name(s): Fur-regulated protein A Staphylococcal transferrin-binding protein A frpA, stbAGene Names: isdAResearch Areas:...

Recombinant Mouse Chemokine-like protein TAFA-1 (Tafa1) | CSB-EP763174MO | CusabioAlternative Name(s): Fam19a1Gene Names: Tafa1Research Areas: Epigenetics and Nuclear SignalingOrganism: Mus musculus(Mouse)AA Sequence:...

Recombinant Vespa mandarinia Vespakinin-M | CSB-EP762592VBR | CusabioAlternative Name(s): Vespakinin-MGene Names: N/AResearch Areas: OthersOrganism: Vespa mandarinia(Asian giant hornet)AA Sequence: GRPPGFSPFRIDSource: E.coliTag Info: N-terminal...

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) | CSB-EP762349ZATa0 | CusabioAlternative Name(s): Membrane-associated protein VP40Gene Names: VP40Research Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)AA...

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) | CSB-EP762349ZAT | CusabioAlternative Name(s): Membrane-associated protein VP40Gene Names: VP40Research Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)AA...

Recombinant Hypocrea rufa Endo-beta-1, 6-galactanase (6GAL) | CSB-EP762323THZ | CusabioAlternative Name(s): 6GALEndo-beta-1,6-galactanase; EC 3.2.1.164Gene Names: 6GALResearch Areas: OthersOrganism: Hypocrea rufa (Trichoderma viride)AA Sequence:...

Recombinant Mycobacterium paratuberculosis DNA integrity scanning protein DisA (disA) | CSB-EP762077MLA | CusabioAlternative Name(s): Cyclic di-AMP synthase (c-di-AMP synthase) (Diadenylate cyclase)Gene Names: disAResearch Areas: OthersOrganism:...

Recombinant Acinetobacter baumannii Beta-lactamase (NDM-1), partial | CSB-EP761ABS | CusabioAlternative Name(s): /Gene Names: NDM-1Research Areas: OthersOrganism: Acinetobacter baumanniiAA Sequence:...

Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15), partial | CSB-EP761623HU | CusabioAlternative Name(s): CD33 antigen-like 3Gene Names: SIGLEC15Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human metapneumovirus Matrix protein (M) | CSB-EP761526HDAM | CusabioAlternative Name(s): M; Matrix proteinGene Names: MResearch Areas: Signal TransductionOrganism: Human metapneumovirus (strain CAN97-83) (HMPV)AA Sequence:...

Recombinant Human Complexin-2 (CPLX2) | CSB-EP761369HU | CusabioAlternative Name(s): Complexin IIGene Names: CPLX2Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Uncharacterized aarF domain-containing protein kinase 2 (Adck2), partial | CSB-EP761222MO | CusabioAlternative Name(s): Adck2Uncharacterized aarF domain-containing protein kinase 2; EC 2.7.11.-Gene Names: Adck2Research Areas:...

Recombinant Human DNA oxidative demethylase ALKBH2 (ALKBH2) | CSB-EP761219HU | CusabioAlternative Name(s): Alkylated DNA repair protein alkB homolog 2 Alpha-ketoglutarate-dependent dioxygenase alkB homolog 2 Oxy DC1Gene Names: ALKBH2Research Areas:...

Recombinant Human Astacin-like metalloendopeptidase (ASTL) | CSB-EP760708HU | CusabioAlternative Name(s): Oocyte astacin (Ovastacin)Gene Names: ASTLResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse C-type lectin domain family 18 member A (Clec18a) | CSB-EP759740MO | CusabioAlternative Name(s): Mannose receptor-like protein (Mrcl) (Mrlp)Gene Names: Clec18aResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Lysine-specific demethylase 3B (KDM3B) , partial | CSB-EP759174HU | CusabioAlternative Name(s): JmjC domain-containing histone demethylation protein 2B Jumonji domain-containing protein 1B Nuclear protein 5qNCAGene Names: KDM3BResearch...

Recombinant Staphylococcus aureus mRNA interferase MazF (mazF) | CSB-EP758890SUL | CusabioAlternative Name(s): Toxin MazF (mRNA interferase MazF)Gene Names: mazFResearch Areas: OthersOrganism: Staphylococcus aureus (strain MW2)AA Sequence:...

Recombinant Listeria monocytogenes serotype 4b Internalin-A (inlA) , partial | CSB-EP758331LAAD | CusabioAlternative Name(s): inlA; LMOf2365_0471; Internalin AGene Names: inlAResearch Areas: OthersOrganism: Listeria monocytogenes serotype 4b (strain...

Recombinant Human Transmembrane protease serine 11A (TMPRSS11A), partial | CSB-EP757932HU | CusabioAlternative Name(s): Airway trypsin-like protease 1;Epidermal type-II transmembrane serine protease;Esophageal cancer-susceptibility gene 1 proteinGene...

Recombinant Human ALK and LTK ligand 1 (ALKAL1) | CSB-EP757795HU | CusabioAlternative Name(s): ALKAL1; FAM150A; UNQ9433/PRO34745ALK and LTK ligand 1; Augmentor beta; AUG-beta; Protein FAM150AGene Names: ALKAL1Research Areas: OthersOrganism: Homo sapiens...

Recombinant Human Angiopoietin-like protein 8 (ANGPTL8) | CSB-EP757793HU | CusabioAlternative Name(s): Betatrophin1 Gene Names: C19orf80Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Arachis hypogaea Conglutin-7 | CSB-EP757666ANE | CusabioAlternative Name(s): Conglutin-7; 2S protein 1; Seed storage protein SSP1; Seed storage protein SSP2; allergen Ara h 2Gene Names: N/AResearch Areas: OthersOrganism: Arachis hypogaea...

Recombinant Mouse Erythroferrone (Erfe) | CSB-EP757647MO | CusabioAlternative Name(s): Complement C1q tumor necrosis factor-related protein 15 MyonectinGene Names: ErfeResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Guinea pig Interleukin-23 subunit alpha (IL23A) | CSB-EP757211GU | CusabioAlternative Name(s): Interleukin-23 subunit alpha;IL-23 subunit alpha;IL-23-A;Interleukin-23 subunit p19;IL-23p19Gene Names: IL23AResearch Areas: CancerOrganism: Cavia...