Others Recombinants

Recombinant Human herpesvirus 6B Protein U24 (U24) | CSB-CF865554HKA | CusabioAlternative Name(s): U24 proteinGene Names: U24Research Areas: OthersOrganism: Human herpesvirus 6B (strain Z29) (HHV-6 variant B) (Human B lymphotropic virus)AA Sequence:...

Recombinant Nipah virus Glycoprotein G (G) | CSB-CF862323NDT | CusabioAlternative Name(s): GGlycoprotein GGene Names: GResearch Areas: OthersOrganism: Nipah virusAA Sequence:...

Recombinant Human P2Y purinoceptor 12 (P2RY12) | CSB-CF861997HU | CusabioAlternative Name(s): ADP-glucose receptor (ADPG-R) (P2T) (P2Y(AC)) (P2Y(cyc)) (P2Y12 platelet ADP receptor) (P2Y(ADP)) (SP1999) (HORK3) (P2Y12)Gene Names: P2RY12Research Areas:...

Recombinant Human Olfactory receptor 13A1 (OR13A1) | CSB-CF854141HU | CusabioAlternative Name(s): Olfactory receptor OR10-3Gene Names: OR13A1Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Gamma-secretase subunit APH-1A (APH1a), partial | CSB-CF853390HU | CusabioAlternative Name(s): Aph-1alpha Presenilin-stabilization factorGene Names: APH1aResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP) | CSB-CF846640HUb3 | CusabioAlternative Name(s): C6orf105Gene Names: ADTRPResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP), Nanodisc | CSB-CF846640HUb1-N | CusabioAlternative Name(s): C6orf105Gene Names: ADTRPResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP) | CSB-CF846640HUb1 | CusabioAlternative Name(s): C6orf105Gene Names: ADTRPResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Small integral membrane protein 4 (SMIM4) | CSB-CF823889HU | CusabioAlternative Name(s): /Gene Names: SMIM4Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Zinc transporter 8 (SLC30A8) | CSB-CF818247HU | CusabioAlternative Name(s): Solute carrier family 30 member 8 (ZNT8)Gene Names: SLC30A8Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant African swine fever virus Major structural protein p17 (Ba71V-107) | CSB-CF806121AEJ | CusabioAlternative Name(s): Ba71V-107; D117L; Major structural protein p17Gene Names: Ba71V-107Research Areas: OthersOrganism: African swine fever virus...

Recombinant Mouse Sialidase-4 (Neu4) | CSB-CF803970MO | CusabioAlternative Name(s): N-acetyl-alpha-neuraminidase 4 (Neuraminidase 4)Gene Names: Neu4Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Ribonuclease kappa (RNASEK) | CSB-CF761293HU | CusabioAlternative Name(s): RNase K (RNase kappa)Gene Names: RNASEKResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human 5-hydroxytryptamine receptor 3D (HTR3D), partial | CSB-CF747864HU | CusabioAlternative Name(s): Serotonin receptor 3DGene Names: HTR3DResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Escherichia coli Probable phosphatidylethanolamine transferase Mcr-1 (mcr1) | CSB-CF745804ENL | CusabioAlternative Name(s): Polymyxin resistance protein MCR-1Gene Names: mcr1Research Areas: OthersOrganism: Escherichia coliAA Sequence:...

Recombinant Human herpesvirus 6A Glycoprotein U22 (U22) | CSB-CF718168HJZ | CusabioAlternative Name(s): /Gene Names: U22Research Areas: othersOrganism: Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)AA Sequence:...

Recombinant Rat MICOS complex subunit Mic60 (Immt), partial | CSB-CF665982RA | CusabioAlternative Name(s): Mitochondrial inner membrane protein (Mitofilin) (Mic60)Gene Names: ImmtResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Hevea brasiliensis Major latex allergen Hev b 5 | CSB-CF662531HWI | CusabioAlternative Name(s): Major latex allergen Hev b 5; allergen Hev b 5Gene Names: N/AResearch Areas: OthersOrganism: Hevea brasiliensis (Para rubber tree) (Siphonia...

Recombinant Halobacterium salinarum Cobalamin import system permease protein BtuC (btuC) | CSB-CF532244HTL(A4) | CusabioAlternative Name(s): btuC; OE_2952FCobalamin import system permease protein BtuCGene Names: btuCResearch Areas: OthersOrganism:...

Recombinan Bombyx mori Cecropin-D (CECD) | CSB-CF524922BTT | CusabioAlternative Name(s): CECDCecropin-DGene Names: CECDResearch Areas: OthersOrganism: Bombyx mori (Silk moth)AA Sequence: GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQSource: in vitro E.coli...

Recombinant Salmo salar Vertebrate ancient opsin, partial | CSB-CF517517SWI | CusabioAlternative Name(s): Vertebrate ancient opsinGene Names: N/AResearch Areas: OthersOrganism: Salmo salar(Atlantic salmon)AA Sequence:...

Recombinant Eisenia fetida Lysenin | CSB-CF515723EJV | CusabioAlternative Name(s): efL1Gene Names: N/AResearch Areas: OthersOrganism: Eisenia fetida (Red wiggler worm)AA Sequence:...

Recombinant Escherichia coli Lactose permease (lacY), partial | CSB-CF365806ENV1 | CusabioAlternative Name(s): Lactose-proton symportGene Names: lacYResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Varicella-zoster virus Envelope glycoprotein E (gE) | CSB-CF362630VAP | CusabioAlternative Name(s): gE; ORF68Envelope glycoprotein E; gEGene Names: gEResearch Areas: OthersOrganism: Varicella-zoster virus (strain Dumas) (HHV-3) (Human...

Recombinant Vaccinia virus Protein L3 (VACWR090) | CSB-CF362179VAI | CusabioAlternative Name(s): Protein F4Gene Names: VACWR090Research Areas: OthersOrganism: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))AA Sequence:...

Recombinant Dog Cationic trypsin | CSB-CF361971DO | CusabioAlternative Name(s): ; Cationic trypsin; EC 3.4.21.4Gene Names: N/AResearch Areas: OthersOrganism: Canis lupus familiaris (Dog) (Canis familiaris)AA Sequence:...

Recombinant Sindbis virus Structural polyprotein, partial | CSB-CF361018SHZb2 | CusabioAlternative Name(s): p130Gene Names: N/AResearch Areas: OthersOrganism: Sindbis virus (SINV)AA Sequence:...

Recombinant Sindbis virus Structural polyprotein, partial | CSB-CF361018SHZ | CusabioAlternative Name(s): p130Gene Names: N/AResearch Areas: OthersOrganism: Sindbis virus (SINV)AA Sequence:...

Recombinant Escherichia coli Colicin-E1 (cea) | CSB-CF360926ENL | CusabioAlternative Name(s): cea; Colicin-E1Gene Names: ceaResearch Areas: OthersOrganism: Escherichia coliAA Sequence:...

Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC), partial | CSB-CF357830LKW(A4) | CusabioAlternative Name(s): GPC; GP-C; Segment; SPre-glycoprotein polyprotein GP complex; Pre-GP-C) [Cleaved into: Stable signal...

Recombinant Dog Anionic trypsin | CSB-CF356954DO | CusabioAlternative Name(s): ; Anionic trypsin; EC 3.4.21.4Gene Names: N/AResearch Areas: OthersOrganism: Canis lupus familiaris (Dog) (Canis familiaris)AA Sequence:...

Recombinant Escherichia coli Adenylate cyclase (cyaA) | CSB-CF355580ENV | CusabioAlternative Name(s): ATP pyrophosphate-lyase Adenylyl cyclaseGene Names: cyaAResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Tetranychus urticae Uncharacterized protein | CSB-CF3511GNY | CusabioAlternative Name(s): /Gene Names: N/AResearch Areas: OthersOrganism: Tetranychus urticae (Two-spotted spider mite)AA Sequence:...

Recombinant Borna disease virus Envelope glycoprotein p57 (G), partial | CSB-CF345219BIN | CusabioAlternative Name(s): gp84 gp94Gene Names: GResearch Areas: OthersOrganism: Borna disease virus (strain V) (BDV)AA Sequence:...

Recombinant Mycoplasma genitalium Uncharacterized protein MG281 (MG281) | CSB-CF341708MLN | CusabioAlternative Name(s): Gene Names: MG281Research Areas: OthersOrganism: Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)AA Sequence:...

Recombinant Escherichia coli Phosphoethanolamine transferase eptA (eptA) | CSB-CF335584ENV | CusabioAlternative Name(s): Polymyxin resistance protein PmrCGene Names: eptAResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Yersinia enterocolitica Protein YopB (yopB) | CSB-CF334228YAQ | CusabioAlternative Name(s): yopB; Protein YopBGene Names: yopBResearch Areas: OthersOrganism: Yersinia enterocoliticaAA Sequence:...

Recombinant Culex quinquefasciatus Odorant receptor (6031407) | CSB-CF3304DZM | CusabioAlternative Name(s): /Gene Names: B0W0I1Research Areas: othersOrganism: Culex quinquefasciatus (Southern house mosquito) (Culex pungens)AA Sequence:...

Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE (yopE) | CSB-CF330087YAQa2 | CusabioAlternative Name(s): yopE; yop25; Outer membrane virulence protein YopEGene Names: yopEResearch Areas: OthersOrganism: Yersinia enterocoliticaAA...

Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE (yopE) | CSB-CF330087YAQ | CusabioAlternative Name(s): yopE; yop25; Outer membrane virulence protein YopEGene Names: yopEResearch Areas: OthersOrganism: Yersinia enterocoliticaAA...

Recombinant Rhodococcus erythropolis SK121 Stearoyl-CoA 9-desaturase (RHOER0001_5437) | CSB-CF3298GMS | CusabioAlternative Name(s): /Gene Names: RHOER0001_5437Research Areas: othersOrganism: Rhodococcus erythropolis SK121AA Sequence:...

Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR), partial | CSB-CF328444VAG1 | CusabioAlternative Name(s): Protein B5Gene Names: PS/HRResearch Areas: OthersOrganism: Vaccinia virus (strain Lister) (VACV)AA Sequence:...

Recombinant Orientia tsutsugamushi 56 KDA type-specific antigen | CSB-CF327749OCJ | CusabioAlternative Name(s): 56 KDA scrub typhus antigen STA56 TSS56Gene Names: N/AResearch Areas: OthersOrganism: Orientia tsutsugamushi(Rickettsia tsutsugamushi)AA...

Recombinant Human cytomegalovirus Uncharacterized protein UL131 (UL131) | CSB-CF323723HWV | CusabioAlternative Name(s): UL131Uncharacterized protein UL131Gene Names: UL131Research Areas: OthersOrganism: Human cytomegalovirus (strain AD169) (HHV-5) (Human...

Recombinant Vaccinia virus Protein I5 (VACWR074) | CSB-CF318298VAI | CusabioAlternative Name(s): Protein VP13KGene Names: VACWR074Research Areas: OthersOrganism: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))AA Sequence:...

Recombinant African swine fever virus Virus attachment protein p12 (Pret-110) | CSB-CF315474AYG | CusabioAlternative Name(s): Protein p12Gene Names: Pret-110Research Areas: OthersOrganism: African swine fever virus (isolate Tick/South Africa/Pretoriuskop...

Recombinant Human Olfactory receptor 5AL1 (OR5AL1) | CSB-CF315097HU | CusabioAlternative Name(s): Olfactory receptor OR11-184Gene Names: OR5AL1Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Rice Amino acid permease (AAP6) | CSB-CF3147OCO | CusabioAlternative Name(s): Gene Names: AAP6Research Areas: OthersOrganism: Oryza sativa (Rice)AA Sequence:...

Recombinant Human herpesvirus 2 Tegument protein VP22 (UL49) | CSB-CF310465HJX | CusabioAlternative Name(s): UL49Tegument protein VP22Gene Names: UL49Research Areas: OthersOrganism: Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus...

Recombinant Human herpesvirus 2 Envelope glycoprotein E (gE) | CSB-CF310072HJX | CusabioAlternative Name(s): gE;gE-2Gene Names: gEResearch Areas: OthersOrganism: Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)AA Sequence:...

Recombinant Human G protein-coupled receptor 20 variant | CSB-CF3008HU | CusabioAlternative Name(s): /Gene Names: N/AResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Gorilla gorilla gorilla Fibroblast growth factor | CSB-CF2954GKM | CusabioAlternative Name(s): FGFGene Names: N/AResearch Areas: OthersOrganism: Gorilla gorilla gorilla (Western lowland gorilla)AA Sequence:...

Recombinant Lactococcus lactis Lipoprotein signal peptidase (lspA), Nanodisc | CSB-CF2619Ba-N | CusabioAlternative Name(s): Prolipoprotein signal peptidase Signal peptidase IIGene Names: lspAResearch Areas: OthersOrganism: Lactococcus lactisAA Sequence:...

Recombinant Lactococcus lactis Lipoprotein signal peptidase (lspA) | CSB-CF2619Ba | CusabioAlternative Name(s): Prolipoprotein signal peptidase Signal peptidase IIGene Names: lspAResearch Areas: OthersOrganism: Lactococcus lactisAA Sequence:...

Recombinant Staphylococcus aureus Enterotoxin type I (SEI) | CSB-CF2248FKZ | CusabioAlternative Name(s): seiGene Names: SEIResearch Areas: OthersOrganism: Staphylococcus aureusAA Sequence:...

Recombinant Cucumber mosaic virus Helicase (ORF1a) | CSB-CF2240CMV | CusabioAlternative Name(s): /Gene Names: ORF1aResearch Areas: OthersOrganism: Cucumber mosaic virus (cucumber mosaic cucumovirus)AA Sequence:...

Recombinant Rice Os03g0263600 protein (Os03g0263600) | CSB-CF2229OFG | CusabioAlternative Name(s): /Gene Names: Os03g0263600Research Areas: OthersOrganism: Oryza sativa subsp. japonica (Rice)AA Sequence:...

Recombinant Plasmodium berghei Uncharacterized protein (PBANKA_093100), partial | CSB-CF2221PLHa2 | CusabioAlternative Name(s): /Gene Names: PBANKA_093100Research Areas: OthersOrganism: Plasmodium berghei (strain Anka)AA Sequence:...

Recombinant Plasmodium berghei Uncharacterized protein (PBANKA_093100), partial | CSB-CF2221PLH | CusabioAlternative Name(s): /Gene Names: PBANKA_093100Research Areas: OthersOrganism: Plasmodium berghei (strain Anka)AA Sequence:...

Recombinant Rice Helix-loop-helix DNA-binding domain containing protein, expressed (LOC_Os11g32100) | CSB-CF2220OGF | CusabioAlternative Name(s): /Gene Names: LOC_Os11g32100Research Areas: OthersOrganism: Oryza sativa subsp. japonica (Rice)AA Sequence:...

Recombinant Laodelphax striatella Carboxylic ester hydrolase (CarE) | CSB-CF2219 | CusabioAlternative Name(s): /Gene Names: CarEResearch Areas: OthersOrganism: Laodelphax striatella (Small brown planthopper)AA Sequence:...

Recombinant Gossypium hirsutum MML3_A12 (MML3) | CSB-CF2218GHB | CusabioAlternative Name(s): /Gene Names: MML3Research Areas: OthersOrganism: Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)AA Sequence:...

Recombinant Human ER membrane protein complex subunit 4 (EMC4) | CSB-CF023887HU | CusabioAlternative Name(s): Cell proliferation-inducing gene 17 protein (Transmembrane protein 85) (TMEM85)Gene Names: EMC4Research Areas: OthersOrganism: Homo sapiens...

Recombinant Human Toll-like receptor 10 (TLR10), partial | CSB-CF023600HUb3 | CusabioAlternative Name(s): CD_antigen: CD290Gene Names: TLR10Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Toll-like receptor 10 (TLR10), partial | CSB-CF023600HU | CusabioAlternative Name(s): CD_antigen: CD290Gene Names: TLR10Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Beta-tectorin (Tectb) | CSB-CF023371MO | CusabioAlternative Name(s): Tectb; Beta-tectorinGene Names: TectbResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Schlafen family member 12-like (SLFN12L) | CSB-CF021762HU | CusabioAlternative Name(s): SLFN12L; SLFN5Schlafen family member 12-likeGene Names: SLFN12LResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Schlafen family member 12 (SLFN12) | CSB-CF021761HUa0 | CusabioAlternative Name(s): FLJ10260; Schlafen family member 12; schlafen family member12; SLFN12; SLFN3; SLN12_HUMANGene Names: SLFN12Research Areas: OthersOrganism: Homo sapiens...

Recombinant Human Schlafen family member 12 (SLFN12) | CSB-CF021761HU | CusabioAlternative Name(s): FLJ10260; Schlafen family member 12; schlafen family member12; SLFN12; SLFN3; SLN12_HUMANGene Names: SLFN12Research Areas: OthersOrganism: Homo sapiens...

Recombinant Mouse Reactive oxygen species modulator 1 (Romo1) | CSB-CF020063MO | CusabioAlternative Name(s): Protein MGR2 homolog (ROS modulator 1)Gene Names: Romo1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Poliovirus receptor (PVR) | CSB-CF019093HU(A4) | CusabioAlternative Name(s): Nectin-like protein 5Gene Names: PVRResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Myelin proteolipid protein (PLP1) | CSB-CF018202HU | CusabioAlternative Name(s): Lipophilin PLPGene Names: PLP1Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Phospholipase D3 (Pld3) | CSB-CF018146MO | CusabioAlternative Name(s): Choline phosphatase 3 (Phosphatidylcholine-hydrolyzing phospholipase D3) (Schwannoma-associated protein 9) (SAM-9) (Sam9) (PLD 3)Gene Names: Pld3Research Areas:...

Recombinant Human Long-wave-sensitive opsin 1 (OPN1LW) | CSB-CF016351HU | CusabioAlternative Name(s): Long-wave-sensitive opsin 1(Red cone photoreceptor pigment)(Red-sensitive opsin)(ROP)Gene Names: OPN1LWResearch Areas: OthersOrganism: Homo sapiens...

Recombinant Human NADPH oxidase 1 (NOX1) | CSB-CF015959HU | CusabioAlternative Name(s): Mitogenic oxidase 1 (MOX-1) (NADH/NADPH mitogenic oxidase subunit P65-MOX) (NOH-1)Gene Names: NOX1Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Neurofilament light polypeptide (NEFL) | CSB-CF015688HU | CusabioAlternative Name(s): 68KDA neurofilament protein Neurofilament triplet L proteinGene Names: NEFLResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Lampetra fluviatilis NADH-ubiquinone oxidoreductase chain 1 (MT-ND1) | CSB-CF015076LNM(A4) | CusabioAlternative Name(s): NADH dehydrogenase subunit 1 MTND1, NADH1, ND1Gene Names: MT-ND1Research Areas: OthersOrganism: Lampetra fluviatilis...

Recombinant Human Potassium channel subfamily K member 3 (KCNK3) | CSB-CF012071HU | CusabioAlternative Name(s): Acid-sensitive potassium channel protein TASK-1 (TWIK-related acid-sensitive K(+) channel 1) (Two pore potassium channel KT3.1) (Two pore K(+)...

Recombinant Human 5-hydroxytryptamine receptor 3E (HTR3E), partial | CSB-CF010894HU | CusabioAlternative Name(s): Serotonin receptor 3EGene Names: HTR3EResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Platelet glycoprotein Ib beta chain (GP1BB) | CSB-CF009686HU | CusabioAlternative Name(s): Antigen CD42b-beta CD_antigen: CD42cGene Names: GP1BBResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Prolyl endopeptidase FAP (Fap), partial | CSB-CF008424MO | CusabioAlternative Name(s): Dipeptidyl peptidase FAPGene Names: FapResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Cysteinyl leukotriene receptor 1 (CYSLTR1) | CSB-CF006465HU | CusabioAlternative Name(s): CysLTR1;Cysteinyl leukotriene D4 receptor;LTD4 receptor;G-protein coupled receptor HG55;HMTMF81Gene Names: CYSLTR1Research Areas: othersOrganism:...

Recombinant Human C-C chemokine receptor type 6 (CCR6) | CSB-CF004845HUa2 | CusabioAlternative Name(s): Chemokine receptor-like 3Gene Names: CCR6Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human C-C chemokine receptor type 6 (CCR6) | CSB-CF004845HU | CusabioAlternative Name(s): Chemokine receptor-like 3Gene Names: CCR6Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human C-C chemokine receptor type 4 (CCR4), Nanodisc | CSB-CF004843HU-N | CusabioAlternative Name(s): K5-5 CD_antigen: CD194Gene Names: CCR4Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human C-C chemokine receptor type 4 (CCR4) | CSB-CF004843HU | CusabioAlternative Name(s): K5-5 CD_antigen: CD194Gene Names: CCR4Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human PRELI domain containing protein 3B (PRELID3B) | CSB-BP896708HU | CusabioAlternative Name(s): Protein slowmo homolog 2Gene Names: PRELID3BResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Serine/arginine repetitive matrix protein 2 (SRRM2), partial | CSB-BP892369HU | CusabioAlternative Name(s): 300 kDa nuclear matrix antigen (Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa) (SR-related...

Recombinant Human DNA-directed DNA/RNA polymerase mu (POLM) | CSB-BP889065HU | CusabioAlternative Name(s): Terminal transferaseGene Names: POLMResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Citrus unshiu Limonoid UDP-glucosyltransferase | CSB-BP888951DTR | CusabioAlternative Name(s): Gene Names: N/AResearch Areas: OthersOrganism: Citrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu)AA Sequence:...

Recombinant Human Protein lin-28 homolog A (LIN28A), partial | CSB-BP884500HU2 | CusabioAlternative Name(s): Zinc finger CCHC domain-containing protein 1Gene Names: LIN28AResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Rattus norvegicus COMM domain-containing protein 5 (Commd5) | CSB-BP880645RA | CusabioAlternative Name(s): Hypertension-related calcium-regulated gene proteinGene Names: Commd5Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA...

Recombinant Arabidopsis thaliana UDP-glycosyltransferase 72E2 (UGT72E2) | CSB-BP873379DOA | CusabioAlternative Name(s): Hydroxycinnamate 4-beta-glucosyltransferase UGT72E2Gene Names: UGT72E2Research Areas: OthersOrganism: Arabidopsis thaliana (Mouse-ear...

Recombinant Arabidopsis thaliana UDP-glycosyltransferase 88A1 (UGT88A1) | CSB-BP864785DOA | CusabioAlternative Name(s): Gene Names: UGT88A1Research Areas: OthersOrganism: Arabidopsis thaliana (Mouse-ear cress)AA Sequence:...

Recombinant Mouse Complement C1q-like protein 3 (C1ql3) | CSB-BP863674MOb1 | CusabioAlternative Name(s): C1q and tumor necrosis factor-related protein 13 (C1q/TNF-related protein 13) (CTRP13) (Gliacolin) (C1ql) (Ctrp13)Gene Names: C1ql3Research Areas:...

Recombinant Crotalus atrox Snake venom serine protease catroxase-2 | CSB-BP854470DYC | CusabioAlternative Name(s): Catroxase II ?Kallikrein-like EI?Gene Names: N/AResearch Areas: OthersOrganism: Crotalus atrox (Western diamondback rattlesnake)AA...

Recombinant Human Zinc finger and SCAN domain-containing protein 1 (ZSCAN1) | CSB-BP843315HU | CusabioAlternative Name(s): Gene Names: ZSCAN1Research Areas: othersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Pleckstrin homology domain-containing family F member 1 (PLEKHF1) | CSB-BP842759HU | CusabioAlternative Name(s): Lysosome-associated apoptosis-inducing protein containing PH and FYVE domains (Apoptosis-inducing protein) (PH and FYVE...

Recombinant Danio rerio Heat shock protein HSP 90-alpha 1 (hsp90a.1), partial | CSB-BP838557DIL | CusabioAlternative Name(s): hsp90 (hsp90a) (hsp90aa1)Gene Names: hsp90a.1Research Areas: OthersOrganism: Danio rerio (Zebrafish) (Brachydanio rerio)AA...

Recombinant Mouse 17-beta-hydroxysteroid dehydrogenase 13 (Hsd17b13) | CSB-BP819744MO | CusabioAlternative Name(s): Alcohol dehydrogenase PAN1B-like (Short-chain dehydrogenase/reductase 9) (17-beta-HSD 13) (Scdr9)Gene Names: Hsd17b13Research Areas:...