Recombinant Zea mays (Maize) Sucrose synthase 1 (SH-1), partial | CSB-EP361346ZAX

(No reviews yet) Write a Review
SKU:
CSB-EP361346ZAX
Availability:
13 - 23 Working Days
  • Recombinant Zea mays (Maize) Sucrose synthase 1 (SH-1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Zea mays (Maize) Sucrose synthase 1 (SH-1), partial | CSB-EP361346ZAX | Cusabio

Alternative Name(s): Shrunken-1 Sucrose-UDP glucosyltransferase 1

Gene Names: SH-1

Research Areas: Others

Organism: Zea mays (Maize)

AA Sequence: NSEHKFVLKDKKKPIIFSMARLDRVKNMTGLVEMYGKNARLRELANLVIVAGDHGKESKDREEQAEFKKMYSLIDEYKLKGHIRWISAQMNRVRNGELYRYICDTKGAFVQPAFYEAFGLTVIESMTCGLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILVNFFDKCKADPSYWDEISQGGLQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYIEMFYALKYRSLASQVPLSFD

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 555-802aa

Sequence Info: Partial

MW: 44.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways. Most active in the sink tissues where it is responsible for the breakdown of the arriving sucrose.

Reference: "Structure of the sucrose synthase gene on chromosome 9 of Zea mays L."Werr W., Frommer W.-B., Maas C., Starlinger P.EMBO J. 4:1373-1380(1985)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways. Most active in the sink tissues where it is responsible for the breakdown of the arriving sucrose.

Involvement in disease:

Subcellular Location:

Protein Families: Glycosyltransferase 1 family, Plant sucrose synthase subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04712

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose