Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) | CSB-EP762349ZAT

(No reviews yet) Write a Review
SKU:
CSB-EP762349ZAT
Availability:
3 - 7 Working Days
  • Recombinant Zaire ebolavirus Matrix protein VP40 (VP40)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) | CSB-EP762349ZAT | Cusabio

Alternative Name(s): Membrane-associated protein VP40

Gene Names: VP40

Research Areas: Others

Organism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)

AA Sequence: MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-326AA

Sequence Info: Full Length

MW: 51.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Promotes virus assbly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma mbrane. Specific interactions with mbrane-associated GP and VP24 during the budding process may also occur. The hexamer form ses to be involved in budding. The octamer form binds RNA, and may play a role in genome replication .

Reference: Chain P.S.G., Ichou M.A., Malfatti S.A., Hajjaj A., Vergez L.M., Paragas J., Do L.H., Jahrling P.B., Smith K.L., McCready P.M., Ibrahim M.S.Crystal structure of the matrix protein VP40 from Ebola virus.Dessen A., Volchkov V., Dolnik O., Klenk H.-D., Weissenhorn W.EMBO J. 19:4228-4236(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Promotes virus assembly and budding by interacting with host proteins of the multivesicular body pathway. May facilitate virus budding by interacting with the nucleocapsid and the plasma membrane. Specific interactions with membrane-associated GP and VP24 during the budding process may also occur. The hexamer form seems to be involved in budding. The octamer form binds RNA, and may play a role in genome replication (By similarity).

Involvement in disease:

Subcellular Location: Virion membrane, Peripheral membrane protein, Host late endosome membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, Cytoplasmic side, Host endomembrane system, Peripheral membrane protein

Protein Families: Filoviridae matrix protein VP40 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q77DJ6

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose