Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) | CSB-BP762349ZAT

(No reviews yet) Write a Review
SKU:
CSB-BP762349ZAT
Availability:
3 - 7 Working Days
$454.80 - $1,272.00

Description

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) | CSB-BP762349ZAT | Cusabio

Alternative Name(s): Ebola VP40 (eVP40) (Membrane-associated protein VP40)

Gene Names: VP40

Research Areas: Others

Organism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)

AA Sequence: MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-326aa

Sequence Info: Full Length

MW: 39.1

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Plays an essential role virus particle assembly and budding. Acts by interacting with viral ribonucleocapsid and host members of the ESCRT system such as host VPS4, PDCD6IP/ALIX, NEDD4 or TGS101. May play a role in immune cell dysfunction by being packaged into exosomes that can decrease the viability of recipient cells.

Reference: "Crystal structure of the matrix protein VP40 from Ebola virus." Dessen A., Volchkov V., Dolnik O., Klenk H.-D., Weissenhorn W. EMBO J. 19:4228-4236(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q77DJ6

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose