Cusabio Yersinia pestis Recombinants
Recombinant Yersinia pestis Outer membrane protein YopM (yopM) | CSB-EP324657YAS
- SKU:
- CSB-EP324657YAS
- Availability:
- 13 - 23 Working Days
Description
Recombinant Yersinia pestis Outer membrane protein YopM (yopM) | CSB-EP324657YAS | Cusabio
Alternative Name(s): yopM; yop48; YPCD1.26c; y5054; y0059; YP_pCD60; Outer membrane protein YopM
Gene Names: yopM
Research Areas: Microbiology
Organism: Yersinia pestis
AA Sequence: MFINPRNVSNTFLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNSLTELPELPQSLKSLLVDNNNLKALSDLPPLLEYLGVSNNQLEKLPELQNSSFLKIIDVDNNSLKKLPDLPPSLEFIAAGNNQLEELPELQNLPFLTAIYADNNSLKKLPDLPLSLESIVAGNNILEELPELQNLPFLTTIYADNNLLKTLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFSGLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLERLIASFNHLAEVPELPQNLKQLHVEYNPLREFPDIPESVEDLRMNSERVVDPYEFAHETTDKLEDDVFE
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-409aa
Sequence Info: Full Length
MW: 62.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Effector proteins function to alter host cell physiology and promote bacterial survival in host tissues.
Reference: "Unusual molecular architecture of the Yersinia pestis cytotoxin YopM: a leucine-rich repeat protein with the shortest repeating unit." Evdokimov A.G., Anderson D.E., Routzahn K.M., Waugh D.S.J. Mol. Biol. 312:807-821(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Effector proteins function to alter host cell physiology and promote bacterial survival in host tissues.
Involvement in disease:
Subcellular Location: Cell outer membrane, Secreted
Protein Families: LRR-containing bacterial E3 ligase family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P17778
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A