Recombinant Yersinia pestis F1 capsule antigen (caf1) | CSB-EP338792YAS

(No reviews yet) Write a Review
SKU:
CSB-EP338792YAS
Availability:
3 - 7 Working Days
  • Recombinant Yersinia pestis F1 capsule antigen (caf1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Yersinia pestis F1 capsule antigen (caf1) | CSB-EP338792YAS | Cusabio

Alternative Name(s): caf1; YPMT1.84; Y1100; YP_pMT082F1 capsule antigen

Gene Names: caf1

Research Areas: Others

Organism: Yersinia pestis

AA Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-170aa

Sequence Info: Full Length of Mature Protein

MW: 19.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Nucleotide sequence of the Yersinia pestis gene encoding F1 antigen and the primary structure of the protein. Putative T and B cell epitopes." Galyov E.E., Smirnov O.Y., Karlishev A.V., Volkovoy K.I., Denesyuk A.I., Nazimov I.V., Rubtsov K.S., Abramov V.M., Dalvadyanz S.M., Zav'Yalov V.P. FEBS Lett. 277:230-232(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted, capsule

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P26948

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose