Cusabio Yersinia enterocolitica Recombinants
Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE (yopE) | CSB-CF330087YAQa2
- SKU:
- CSB-CF330087YAQa2
- Availability:
- 18 - 23 Working Days
Description
Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE (yopE) | CSB-CF330087YAQa2 | Cusabio
Alternative Name(s): yopE; yop25; Outer membrane virulence protein YopE
Gene Names: yopE
Research Areas: Others
Organism: Yersinia enterocolitica
AA Sequence: MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM
Source: in vitro E.coli expression system
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-219aa
Sequence Info: Full Length
MW: 38.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis
Reference: "Secretion of Yop proteins by Yersiniae."Michiels T., Wattiau P., Brasseur R., Ruysschaert J.M., Cornelis G.Infect. Immun. 58:2840-2849(1990)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis.
Involvement in disease:
Subcellular Location: Cell outer membrane
Protein Families: YopE family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P31492
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A