Recombinant Yersinia enterocolitica Invasin, partial | CSB-EP321672YAQ

Recombinant Yersinia enterocolitica Invasin, partial | CSB-EP321672YAQ | Cusabio

Alternative Name(s): Invasin

Gene Names: N/A

Research Areas: Microbiology

Organism: Yersinia enterocolitica

AA Sequence: VNGEQFATDKGFPKTTFNKATFQLVMNDDVANNTQYDWTSSYAASAPVDNQGKVNIAYKTYGSTVTVTAKSKKFPSYTATYQFKPNLWVFSGTMSLQSSVEASRNCQRTDFTALIESARASNGSRSPDGTLWGEWGSLATYDSAEWPSGNYWTKKTSTDFVTMDMTTGDIPTSAATAYPLCAEPQ

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 651-835aa

Sequence Info: Partial

MW: 36.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Invasin is a protein that allows enteric bacteria to penetrate cultured mammalian cells. The entry of invasin in the cell is mediated by binding several beta-1 chain integrins.

Reference: "Sequence, localization and function of the invasin protein of Yersinia enterocolitica."Young V.B., Miller V.L., Falkow S., Schoolnik G.K.Mol. Microbiol. 4:1119-1128(1990).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Invasin is a protein that allows enteric bacteria to penetrate cultured mammalian cells. The entry of invasin in the cell is mediated by binding several beta-1 chain integrins.

Involvement in disease:

Subcellular Location: Cell outer membrane

Protein Families: Intimin/invasin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P19196

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A