Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail) | CSB-EP322286YAQ

(No reviews yet) Write a Review
SKU:
CSB-EP322286YAQ
Availability:
3 - 7 Working Days
  • Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Yersinia enterocolitica Attachment invasion locus protein (ail) | CSB-EP322286YAQ | Cusabio

Alternative Name(s): ailAttachment invasion locus protein

Gene Names: ail

Research Areas: Others

Organism: Yersinia enterocolitica

AA Sequence: ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 24-178aa

Sequence Info: Full Length of Mature Protein

MW: 33.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Promotes the invasion of pathogenic bacteria into eukaryotic cells by an unknown mechanism.

Reference: "Nucleotide sequence of the Yersinia enterocolitica ail gene and characterization of the Ail protein product." Miller V.L., Bliska J.B., Falkow S. J. Bacteriol. 172:1062-1069(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Promotes the invasion of pathogenic bacteria into eukaryotic cells by an unknown mechanism.

Involvement in disease:

Subcellular Location: Cell outer membrane, Multi-pass membrane protein

Protein Families: Ail/OmpX/PagC/Lom family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P16454

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose