Recombinant Xenopus laevis Transthyretin (ttr) | CSB-YP025270XBE

(No reviews yet) Write a Review
SKU:
CSB-YP025270XBE
Availability:
25 - 35 Working Days
$459.60 - $1,614.00

Description

Recombinant Xenopus laevis Transthyretin (ttr) | CSB-YP025270XBE | Cusabio

Alternative Name(s): Transthyretin(xTTR)(Prealbumin)

Gene Names: ttr

Research Areas: Others

Organism: Xenopus laevis (African clawed frog)

AA Sequence: APPGHASHGEADSKCPLMVKVLDAVRGIPAANLLVNVFRQTESGKWEQITSGKTTELGEIHNLTTDEQFTEGVYKIEFATKAFWGKLGLSPFHEYVDVVFTANDAGHRHYTIAVLLTPYSFSSTAIVSEPHDDL

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 20-153aa

Sequence Info: Full Length of Mature Protein

MW: 16.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Thyroid hormone-binding protein, with a much higher binding affinity for triiodothyronine (T3) than for thyroxine (T4). Probably transports triiodothyronine from the bloodstream to the brain.

Reference: "In vitro and in vivo analysis of the thyroid system-disrupting activities of brominated phenolic and phenol compounds in Xenopus laevis." Kudo Y., Yamauchi K., Fukazawa H., Terao Y. Toxicol. Sci. 92:87-95(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: B7ZS96

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose