Recombinant Xenopus laevis Histone H1.0-A (h1f0-a) | CSB-EP332862XBE

(No reviews yet) Write a Review
SKU:
CSB-EP332862XBE
Availability:
13 - 23 Working Days
  • Recombinant Xenopus laevis Histone H1.0-A (h1f0-a)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Xenopus laevis Histone H1.0-A (h1f0-a) | CSB-EP332862XBE | Cusabio

Alternative Name(s): H1-SB H1E Histone H1(0)-1 Histone H5B XlH5B

Gene Names: h1f0-a

Research Areas: Epigenetics and Nuclear Signaling

Organism: Xenopus laevis (African clawed frog)

AA Sequence: MTENSAPAAKPRRSKASKKSTDHPKYSDMILDAVQAEKSRSGSSRQSIQKYIKNNYTVGENADSQIKLSIKRLVTSGTLKQTKGVGASGSFRLAKADEVKKPAKKPKKEIKKAVSPKKAAKPKKAAKSPAKAKKPKVAEKKVKKAPKKKPAPSPRKAKKTKTVRAKPVWASKAKKAKPSKPKAKASPKKSGRKK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-194aa

Sequence Info: Full Length

MW: 37 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division (By similarity).

Reference: "Characterization of the two H1(0)-encoding genes from Xenopus laevis."Brocard M., Triebe S., Peretti M., Doenecke D., Khochbin S.Gene 189:127-134(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division (By similarity).

Involvement in disease:

Subcellular Location: Nucleus, Chromosome

Protein Families: Histone H1/H5 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P22845

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose