Recombinant White-rot fungus Cellobiose dehydrogenase (CDH-1), partial | CSB-YP312474EUK

Recombinant White-rot fungus Cellobiose dehydrogenase (CDH-1), partial | CSB-YP312474EUK | Cusabio

Alternative Name(s): Cellobiose-quinone oxidoreductase

Gene Names: CDH-1

Research Areas: Microbiology

Organism: Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum)

AA Sequence: QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 19-208aa

Sequence Info: Partial

MW: 22.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Degrades both lignin and cellulose. Oxidizes cellobiose to cellobionolactone.

Reference: "Cellobiose dehydrogenase from Phanerochaete chrysosporium is encoded by two allelic variants."Li B., Nagalla S.R., Renganathan V.Appl. Environ. Microbiol. 63:796-799(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Degrades both lignin and cellulose. Oxidizes cellobiose to cellobionolactone.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: GMC oxidoreductase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q01738

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A