Recombinant Viscum album Chitin-binding lectin | CSB-EP305626VDO

(No reviews yet) Write a Review
SKU:
CSB-EP305626VDO
Availability:
3 - 7 Working Days
  • Recombinant Viscum album Chitin-binding lectin
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Viscum album Chitin-binding lectin | CSB-EP305626VDO | Cusabio

Alternative Name(s): /

Gene Names: N/A

Research Areas: others

Organism: Viscum album (European mistletoe)

AA Sequence: IDHRCGREATPPGKLCNDGRCCSQWGWCGTTQAYCSGKCQSQCDCNRDL

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-49aa

Sequence Info: Full Length

MW: 32.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Chitin-binding lectin which is specific for N-acetylglucosamine oligomers.

Reference: "Complete structural characterization of a chitin-binding lectin from mistletoe extracts." Voelter W., Wacker R., Franz M., Maier T., Stoeva S. J. Prakt. Chem. 342:812-818(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P81859

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose