Recombinant Vibrio vulnificus Fe/S biogenesis protein NfuA (nfuA) | CSB-EP813457VFI

(No reviews yet) Write a Review
SKU:
CSB-EP813457VFI
Availability:
13 - 23 Working Days
  • Recombinant Vibrio vulnificus Fe/S biogenesis protein NfuA (nfuA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Vibrio vulnificus Fe/S biogenesis protein NfuA (nfuA) | CSB-EP813457VFI | Cusabio

Alternative Name(s): nfuA; VV1_0864; Fe/S biogenesis protein NfuA

Gene Names: nfuA

Research Areas: Microbiology

Organism: Vibrio vulnificus (strain CMCP6)

AA Sequence: MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-194aa

Sequence Info: Full Length

MW: 25 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins.

Reference: "Complete genome sequence of Vibrio vulnificus CMCP6."Rhee J.H., Kim S.Y., Chung S.S., Kim J.J., Moon Y.H., Jeong H., Choy H.E.Submitted (DEC-2002).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins.

Involvement in disease:

Subcellular Location:

Protein Families: NfuA family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8DDU2

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose